Details for Kale Locus Bo5g155270

Position : C5 ( 5`- 46767172 .. 46768324 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155270

Protein [Map View]
MDWRMEIFRKAAIVRLHSHNGKYLTADEDQESVHQNRRGTTKNTRWTVEIVPGSNVIRLQSCYGKYLTASNNHFLLGATG
KKVLQTLRAKLDSSAEWEPISDNGKHVRFKSRYGQYLRANKGLPPWRNSITHDIPSRTVTQDWVLWSVDVLQVRVINDDA
ESTHSSSSFSRVASGDSFTVSLPPKSEGRLIYYEIRDDCGNINNDEVGEKSLIFHGSELTELKKKLEEETGIQDLIVCSR
NPLHDAKLCPLQLHLPPNNATMHVIIVPPSLGTILLL*

DNA
ATGGATTGGAGGATGGAGATATTTCGAAAGGCAGCGATTGTGCGGCTCCATAGCCACAACGGAAAGTACCTAACCGCCGA
CGAAGACCAAGAATCCGTTCATCAAAACCGTCGCGGCACAACTAAAAACACCCGATGGACCGTTGAGATTGTTCCTGGGT
CTAATGTCATTCGTCTTCAAAGCTGTTACGGCAAATACCTAACCGCCTCTAATAATCATTTCCTCCTCGGAGCCACCGGT
AAAAAGGTACTTCAAACCTTACGGGCAAAGTTGGATTCGTCGGCAGAGTGGGAACCAATATCGGACAATGGCAAACACGT
ACGGTTCAAGAGTCGTTATGGACAATATCTAAGAGCTAACAAAGGTTTACCGCCTTGGAGAAACTCTATCACACACGATA
TCCCTAGCCGTACAGTCACACAAGATTGGGTCCTGTGGAGTGTTGATGTTCTCCAAGTTCGAGTTATCAACGATGATGCT
GAATCTACCCATAGTTCTTCCTCATTTTCACGGGTCGCGTCAGGTGATTCATTTACTGTGAGCTTACCACCAAAATCCGA
AGGAAGACTGATATATTACGAGATCAGAGATGATTGTGGGAACATAAATAACGACGAAGTGGGAGAAAAATCATTGATAT
TCCATGGAAGCGAGTTGACAGAATTGAAGAAGAAACTAGAGGAAGAAACAGGGATCCAAGATCTTATTGTTTGCTCTAGA
AACCCTTTGCATGATGCGAAGCTTTGTCCTCTTCAGTTGCATCTCCCTCCCAATAACGCAACAATGCACGTCATCATCGT
TCCTCCTTCACTCGGTACTATACTTCTCCTTTGA