Details for Kale Locus Bo5g155260

Position : C5 ( 5`- 46759067 .. 46764737 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155260

Protein [Map View]
MFMVLALVSALVFLQSQAGNYCSLENINSIPGCFDALKLATGKDISKLTRACCRAVFSRRRSFRWRLESEKTDDMSEDDG
KEVDGLCRNITYIPMDLQSNNVLKAATQIISETRRNLKRSQAIEAHPASFSQSKVVGGFSGNDNEDKWQVVMVQLVCFLV
VSMRDTKNDMKLLIYTTLLSLVSALVFLQSEAGNYCPTENINSIPGCFDALKLASGKDYRRLTRDCCRAVFSVIPDTCFL
LLFPGKAYPIKMFRNICLNVNYVSAASPF*

DNA
ATGTTTATGGTGTTAGCCCTAGTCTCGGCATTGGTTTTCCTACAATCACAAGCTGGTAATTATTGTTCGCTGGAAAATAT
AAATAGCATACCAGGATGTTTCGATGCGTTGAAATTAGCAACAGGCAAAGATATCAGTAAGCTAACAAGAGCTTGTTGCA
GAGCAGTCTTTTCACGACGGCGATCATTTCGATGGCGATTAGAGTCTGAAAAAACTGATGACATGTCTGAGGATGACGGA
AAGGAAGTAGACGGTTTGTGCAGGAATATTACATACATACCGATGGATCTTCAGTCAAATAATGTCTTAAAAGCAGCTAC
TCAAATAATCTCTGAGACCAGAAGAAACTTAAAGCGGAGCCAGGCTATTGAAGCACATCCTGCTTCATTTTCTCAGTCTA
AGGTGGTAGGTGGTTTCAGTGGCAATGATAATGAGGATAAGTGGCAGGTGGTGATGGTACAGTTGGTTTGTTTCTTGGTT
GTCTCGATGAGAGACACAAAGAATGACATGAAGCTTTTGATATACACAACTTTGCTATCCCTAGTCTCGGCATTGGTTTT
CCTACAATCAGAAGCTGGTAATTATTGTCCGACAGAAAATATAAATAGCATACCAGGATGTTTCGATGCGTTGAAATTAG
CATCAGGCAAAGATTACAGAAGGCTAACAAGAGATTGTTGCAGAGCAGTCTTTTCAGTAATCCCTGATACTTGCTTCTTG
CTTCTCTTTCCTGGCAAAGCTTACCCTATTAAGATGTTCAGAAACATTTGTCTTAATGTTAATTATGTTTCTGCTGCTTC
ACCTTTTTAA