Details for Kale Locus Bo5g155250

Position : C5 ( 5`- 46755593 .. 46757660 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155250

Protein [Map View]
MEKMPWIVSSQDVDALALQSYSRKEKSLGVLVSNFVRIYNRDDVDLFGIDEAAAKLGVERRRIYDVVNILESIEVVSRKG
KNLYSWNGFLHIPRSLHQLKEEGLREGFGTSSICSNSDKVSHDDESEESFSLTPDDQDNSSLSKLDHKKESSLWLLSQNF
VKMFLCSHDDLITLDSAAKALLSDSQDPMHMRTKVRRLYDIANVLSSMELIEKTHIPGTRKPAYKWLGSKSLTEKGSSLF
NSPNESKKRVFGTEITNLSTKRNKTDCSSNYVQNGYKKHDEEEKKPAAKSYVFGPFSPTAASKKNNINNAGTSNSGRLQD
LEALSSAYKPQYCNQDVTGLLGHYTEAWNKWFAELDRK*

DNA
ATGGAGAAAATGCCATGGATAGTGTCGTCTCAAGATGTGGATGCTCTCGCTCTCCAATCGTATAGCCGCAAGGAGAAATC
TCTAGGCGTTCTCGTCTCCAATTTCGTGAGGATATATAATCGAGACGATGTTGATTTGTTTGGCATCGATGAGGCGGCTG
CCAAATTAGGAGTTGAACGACGGCGTATATATGATGTGGTTAATATACTGGAGAGCATTGAGGTTGTGTCTAGAAAAGGG
AAGAATCTTTACTCTTGGAATGGTTTTCTACACATTCCTCGTTCTCTTCATCAGCTCAAGGAAGAAGGTTTGAGAGAGGG
TTTTGGTACCTCTAGTATCTGCAGCAACTCAGACAAGGTTTCACATGACGATGAAAGTGAAGAGTCCTTCAGTTTAACGC
CTGATGATCAAGACAACTCCTCCCTCTCTAAATTGGACCACAAGAAGGAGAGTTCTCTCTGGCTACTCTCCCAGAACTTT
GTTAAGATGTTTCTTTGCTCTCATGATGATCTCATCACACTGGATAGTGCTGCCAAAGCCTTGCTGAGCGACTCTCAAGA
TCCAATGCATATGAGAACTAAAGTTAGGCGGCTTTACGACATTGCAAATGTGTTATCCTCCATGGAGTTAATCGAGAAGA
CTCATATACCAGGAACTAGGAAACCAGCTTATAAGTGGTTGGGGTCCAAAAGCTTAACCGAAAAAGGATCAAGCTTGTTT
AACTCCCCCAATGAATCGAAGAAGCGGGTCTTTGGAACAGAGATCACCAACTTGAGTACAAAGAGAAACAAAACAGATTG
TTCATCAAACTACGTACAAAACGGATATAAGAAACATGACGAGGAGGAAAAGAAACCAGCTGCAAAGAGCTATGTGTTTG
GCCCATTCTCACCAACAGCTGCATCTAAGAAGAACAACATCAACAATGCTGGAACCAGTAATAGTGGAAGGCTGCAAGAT
CTCGAGGCCCTTTCTTCTGCATACAAACCTCAGTATTGCAATCAAGATGTAACTGGTCTTCTTGGGCATTACACGGAGGC
ATGGAACAAATGGTTTGCAGAGCTTGATCGCAAATAA