Details for Kale Locus Bo5g155240

Position : C5 ( 5`- 46754193 .. 46755101 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155240

Protein [Map View]
MPPQKIETGHSDIVHDVVMDYYGKRIATASSDGTIKITGVSNSGGSQQLATLTGHRGPVWQVAWAHPKYDSLLASCSYDG
QIIIWKEGNQNEWTQSHVFTDHKVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTRIDQAHPVGVTSVSWAP
ATEPGALVSSGMHEPVYKLASGGCDSTVKVWKFANGSWKMDCFPALHKHKDWVRDVAWAPNLGLPKSTIASGSEDGSVII
WTVGKEGEQWEGKVLKDFKTPVWRVTWSLTGNLLAVSDGNNNVTVWKEAVDGEWEQVTVVEP*

DNA
ATGCCTCCGCAGAAGATCGAGACGGGTCACAGCGACATTGTCCACGATGTCGTCATGGATTACTATGGAAAGCGAATAGC
AACTGCCTCATCAGACGGCACCATCAAGATAACCGGAGTGAGCAACAGCGGCGGATCTCAGCAGCTAGCTACCTTAACCG
GCCACCGAGGTCCCGTCTGGCAAGTCGCCTGGGCCCACCCGAAGTACGATTCGCTCCTCGCTTCGTGCTCATACGATGGG
CAAATCATAATATGGAAAGAAGGAAACCAAAACGAGTGGACGCAGTCTCACGTCTTCACAGACCACAAAGTATCAGTCAA
CTCCATCGCCTGGGCTCCTCACGAGCTCGGTCTCTCCTTAGCTTGCGGAGCATCCGACGGAAACATTTCTGTTTTCTCGG
CCAGAGCCGATGGAGGTTGGGACACGACGAGGATAGACCAAGCTCACCCGGTCGGAGTCACTTCGGTGTCGTGGGCACCA
GCGACGGAGCCAGGGGCGCTCGTTAGCTCCGGTATGCACGAACCGGTCTACAAGTTAGCGTCGGGAGGGTGTGATAGTAC
GGTGAAGGTGTGGAAATTCGCAAACGGGTCGTGGAAGATGGACTGTTTCCCTGCGCTTCACAAGCACAAGGACTGGGTGC
GTGACGTGGCGTGGGCACCGAACTTGGGTCTGCCGAAGTCGACGATAGCGAGCGGGTCGGAAGATGGGAGTGTGATCATA
TGGACGGTGGGGAAAGAAGGAGAGCAGTGGGAAGGGAAGGTATTGAAAGATTTCAAGACGCCGGTGTGGAGGGTGACGTG
GTCGTTGACGGGTAACTTGCTGGCGGTGTCGGATGGGAACAATAACGTAACGGTGTGGAAAGAGGCTGTGGATGGAGAGT
GGGAGCAAGTGACCGTCGTTGAGCCTTAG