Details for Kale Locus Bo5g155230

Position : C5 ( 5`- 46744339 .. 46746850 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155230

Protein [Map View]
MDMEQKTRGLGKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLFSAPLADAYWDRFF
TILASSSVYFVGLVGLTWTAFAGSRSATKTISTYFLYSSLCLVSIGLGVLNPSLQAFGADQLDHDLDKEFELLSGDQKDA
KATRKTQFFQWWYFGVCAGSLMGVTVMAYIQDTFGWVLGFAIPGIAMFLLILLFLSGCGIYVYGAGTGTGLKTKTTPTPF
EKILKFIKGRVVKKKKKQRSTYTLADEEDLDDMELELQERPLCECDDDAEPEDIEKASTTPQKMDDESSKPSFSGTDTIK
LVLRLLPIWTMLLMFAVIFQLPATFFTKQGMTMKRNIGPSFKIPPATLQSTITLSIILLMPLYEKILIPVTKRIKNNGQG
ISVMERMGVGMFLSIIAIVIAALVERKRLDISQKVKTLPDYDPETVPFSIFWLLPQYILLGISDIFTVVGMQEFFYSEVP
VRMRTMGFALYTSVFGVGSFVSAGLISVVEAYSTSTGEGQNWFADDMSEARLDKYYWLLALTSTISFVVYIVLCKYFKSS
SDQGSEEEKAPK*

DNA
ATGGATATGGAACAGAAGACAAGAGGACTTGGCAAGTCATGTGCTCTTCTCATAGTGATTGCGGGAATGGAGAGATATGC
GTTTAAAGGAGTTGCATCAAACTTAGTGACATATCTAACAGATGTGGTGAAGATGAGTAACTCAAGAGCAGCCAAGACAG
TTAATACTTGGGCGGGTTTCACTTCTATGTTGCCTCTCTTCTCTGCTCCTTTGGCTGATGCGTATTGGGATAGATTCTTC
ACTATCCTTGCTTCTTCTTCTGTCTACTTTGTGGGGCTAGTGGGACTGACATGGACGGCATTTGCTGGGTCACGTTCAGC
TACAAAGACAATCTCCACCTATTTTCTCTACTCATCACTATGTCTGGTCTCAATCGGGTTAGGTGTCTTAAACCCTTCTC
TTCAAGCCTTTGGTGCGGACCAGCTTGACCACGACCTTGATAAGGAGTTTGAGCTTCTCTCCGGTGATCAAAAAGACGCC
AAAGCTACTCGAAAAACTCAGTTTTTTCAATGGTGGTACTTTGGCGTCTGCGCTGGAAGCCTTATGGGTGTCACAGTCAT
GGCTTATATCCAAGACACTTTTGGTTGGGTCCTCGGTTTTGCAATACCCGGAATAGCCATGTTCCTGTTGATCTTGTTGT
TCTTGTCGGGTTGCGGGATCTATGTTTATGGTGCTGGTACTGGTACGGGTTTGAAGACGAAAACAACTCCTACACCTTTT
GAGAAGATCCTTAAGTTCATCAAAGGGAGAGTAGTGAAGAAGAAGAAGAAGCAGAGAAGCACATATACACTTGCAGATGA
GGAAGATTTGGATGATATGGAGCTAGAGTTACAAGAGAGGCCTCTTTGTGAATGCGATGATGACGCTGAGCCTGAAGACA
TTGAAAAAGCTTCAACAACCCCACAGAAAATGGATGATGAAAGTTCGAAACCGAGCTTCTCTGGAACTGATACAATCAAG
TTAGTGCTTCGTCTTTTGCCCATATGGACGATGCTTCTCATGTTTGCGGTTATCTTCCAGCTACCAGCGACCTTTTTCAC
CAAACAAGGCATGACCATGAAGCGAAACATCGGTCCCAGCTTCAAAATCCCCCCTGCGACCCTGCAAAGCACCATTACTC
TATCCATAATCCTTCTCATGCCGCTGTACGAGAAGATCTTGATCCCTGTCACCAAAAGAATCAAGAACAACGGCCAAGGC
ATCTCCGTGATGGAGAGAATGGGAGTTGGAATGTTCCTATCTATCATAGCCATTGTTATTGCGGCGCTAGTCGAAAGGAA
AAGACTAGACATAAGCCAAAAGGTGAAGACTTTGCCTGACTACGATCCAGAAACCGTCCCGTTCAGCATCTTCTGGCTGT
TACCTCAGTACATACTCCTGGGGATCTCGGATATATTCACAGTGGTTGGGATGCAAGAGTTCTTCTACAGCGAGGTTCCG
GTTAGAATGAGAACAATGGGGTTTGCTCTCTACACAAGTGTCTTTGGCGTTGGAAGCTTTGTGAGCGCAGGGCTGATCTC
AGTCGTGGAGGCTTACTCGACCTCAACAGGTGAAGGGCAAAACTGGTTTGCAGATGATATGTCGGAAGCTAGGCTAGACA
AATACTACTGGCTGCTTGCTCTTACAAGTACTATTAGCTTTGTGGTCTACATAGTTCTATGCAAGTATTTCAAGAGTAGT
AGTGATCAAGGCAGTGAAGAAGAAAAAGCCCCTAAATAA