Details for Kale Locus Bo5g155220

Position : C5 ( 5`- 46743148 .. 46744098 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155220

Protein [Map View]
MGILSYAVAGGGFAVIGAWESLDSSNLDPNPSTGTDPSSPTAAQITPSPPKSVGSSSVPVALLSSLFIANSIYSFFSSIG
SSDRVGSMLQLQILAVAALFLVYAVVTHLVNSKNGGFAALPSSITSLLLLFGFIEEFLMFYLQKKDTSGIENRYYDLMLV
PIAVCVFSTVFELKSDATTHRFAKLGRGIGLILQGTWFLQMGISFFTGLITNNCSFHEKSRGNFTIKCKGHGDYHRAKAI
ATLQFNCHLALMVVLATALFSVVANKKGYLREEDHSKYRPLGAEMENLSNFTLDSDEEDSNVAKETALNGIITSHA*

DNA
ATGGGTATATTGAGTTACGCCGTCGCCGGCGGCGGGTTTGCGGTAATCGGCGCGTGGGAGTCACTGGACTCATCGAACCT
TGATCCGAATCCATCTACCGGTACTGATCCGTCTTCCCCTACGGCGGCTCAGATCACTCCGTCTCCGCCCAAATCAGTTG
GATCGTCTTCCGTCCCCGTAGCTTTGCTTTCGTCTCTGTTCATAGCCAACTCGATTTACTCCTTCTTCAGCTCAATCGGA
TCCAGCGACCGGGTCGGATCGATGCTCCAGTTACAGATCCTGGCGGTCGCAGCTTTATTCCTAGTGTACGCCGTCGTAAC
CCATCTGGTCAACTCCAAAAACGGAGGCTTTGCAGCTCTTCCGTCTTCGATCACGAGCCTGTTGCTTCTCTTCGGCTTCA
TCGAGGAGTTTCTCATGTTCTACCTCCAGAAGAAGGACACATCCGGAATCGAGAATCGCTACTACGATCTCATGCTCGTC
CCCATCGCCGTCTGCGTCTTCTCCACGGTCTTCGAGCTCAAATCCGACGCAACCACGCATCGATTCGCGAAGCTAGGGCG
CGGGATCGGGTTGATTCTGCAAGGAACGTGGTTTCTGCAAATGGGTATATCGTTTTTCACGGGGTTGATCACTAACAACT
GCTCGTTTCACGAGAAGAGCAGAGGCAATTTCACCATCAAGTGCAAAGGACACGGTGATTATCACAGGGCCAAAGCTATC
GCTACGCTTCAGTTTAACTGCCATTTGGCTCTCATGGTGGTTTTAGCTACCGCGTTGTTCTCCGTCGTCGCGAACAAGAA
AGGTTATCTCCGTGAAGAAGATCATTCAAAGTATCGGCCTCTCGGAGCTGAGATGGAAAATTTAAGTAACTTCACTCTCG
ATTCTGATGAAGAAGATAGTAACGTAGCTAAGGAAACTGCTCTTAATGGAATCATCACCTCACACGCTTAA