Details for Kale Locus Bo5g155190

Position : C5 ( 5`- 46731498 .. 46732608 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155190

Protein [Map View]
MESSRGQGGIQQLLAAEQEAQHIVNAARTAKMARLKQAKEEAEKEIAEYKAKTEQDFQRKLEETSGDSGANVKRLEQETD
AKIEQLKKEASRISNDVVAMLLKHVTTVKN*

DNA
ATGGAGTCCAGCAGAGGTCAAGGTGGGATCCAGCAGTTGCTTGCTGCTGAACAGGAAGCTCAACACATTGTCAATGCTGC
CAGGACCGCAAAGATGGCAAGGCTGAAGCAGGCCAAGGAAGAGGCTGAGAAGGAGATAGCTGAATACAAAGCTAAAACAG
AGCAAGACTTCCAGAGGAAACTTGAGGAGACAAGTGGAGACTCGGGTGCGAATGTGAAGAGGCTGGAGCAGGAGACTGAT
GCCAAAATCGAACAGCTGAAGAAGGAAGCTTCCAGGATCTCCAATGATGTTGTGGCGATGCTCCTCAAACATGTCACCAC
TGTCAAGAACTGA