Details for Kale Locus Bo5g155180

Position : C5 ( 5`- 46725591 .. 46729977 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155180

Protein [Map View]
MKVISSLISSVFLKFIHKDFHEVYSRMPVLDRIILLIVHAVDTMVPWHKLPVFLGMAYLGLRRHLHQEYNLINVGQTPVG
TRFNPADYPYRTADGKFNDPFNEGVGSQYSFIGRNCPPVDQKTKLLKPDPMVVATKLLARRKLIDTGKQFNMIAASWIQF
MIHDWVDHLEETNQIELVAPKEVANECPLSSFRFFKTKEVPTGFFEIKTGSLNSRTPWWDSSVIYGSNSKAMDRVRTYKD
GKLKLSEETGLLLQDQDGLAISGDVRNSWVGVSALQALFVKEHNAVCDALKKEYDDLEDEDLYRHARLVTSAVIAKIHTI
DWTVELLKTDTLLAGMRTNWYGILGKKFKDSFGHVGSSILGGLVGMKKPQNHGVPYSITEDFTSVYRMHSLLPDQLELRD
IDVVPGTNKSLPLIEEVSFGKLLGPKGEQTMSHIGFTKLMVSMGHQASGALELMNYPVWLRDLVPHDPNGYDRPDHIDLA
ALEIYRDRERNVARYNEFRRSMFMIPIKKWEDLTDDKEAIEALEDVYGGNVEELDLLVGLMAEKKIKGFAISETAFNIFV
IMATRRLEADRFFTSDFNEMTYTKKGLEWVNTTESLRDVFDRHYPEMTDRWMNSESAFSVWDSPPVAKNPIPLYLRVPSS
*

DNA
ATGAAAGTAATAAGTTCTTTAATCTCTTCTGTTTTTCTCAAATTCATCCACAAAGATTTCCACGAGGTTTACTCAAGAAT
GCCCGTCTTGGATCGTATCATACTTCTTATCGTGCATGCAGTGGATACGATGGTTCCGTGGCACAAGCTTCCGGTTTTCT
TGGGTATGGCCTACCTAGGGTTGCGCAGACATCTTCACCAAGAATATAATCTCATCAATGTTGGTCAAACTCCGGTTGGG
ACCCGGTTTAATCCTGCTGACTATCCGTACCGGACTGCTGACGGAAAATTTAATGATCCGTTCAACGAAGGCGTCGGCAG
CCAATATAGCTTCATCGGAAGAAATTGTCCTCCTGTTGATCAGAAGACCAAGTTACTGAAGCCAGACCCCATGGTAGTGG
CGACAAAACTATTAGCAAGAAGAAAGTTGATCGACACGGGAAAACAGTTTAATATGATTGCAGCTTCTTGGATACAATTC
ATGATTCATGATTGGGTTGATCATCTTGAAGAAACTAATCAGATTGAGCTCGTGGCTCCAAAAGAAGTAGCGAACGAGTG
TCCCTTAAGCTCCTTCAGATTCTTCAAGACAAAGGAAGTTCCTACAGGTTTCTTCGAGATCAAGACCGGTTCGTTAAATT
CCCGTACACCTTGGTGGGATTCGAGCGTCATCTATGGAAGCAACTCGAAAGCAATGGACAGAGTGAGGACTTACAAAGAC
GGGAAACTAAAGTTATCGGAGGAGACGGGTCTCTTACTCCAAGACCAAGACGGTTTAGCCATTTCCGGCGACGTACGTAA
CAGTTGGGTCGGTGTCTCCGCCTTGCAAGCTCTCTTCGTCAAAGAGCACAATGCCGTATGCGACGCCCTCAAGAAGGAGT
ACGATGATTTGGAAGACGAGGATTTGTACCGCCATGCTAGGCTAGTGACGTCAGCAGTGATTGCCAAGATTCACACCATA
GATTGGACCGTTGAGCTTCTTAAAACCGACACTTTACTTGCCGGGATGCGAACAAATTGGTACGGAATTTTAGGAAAGAA
GTTTAAAGATTCGTTCGGACATGTAGGGAGTTCCATCTTGGGAGGTCTCGTGGGTATGAAGAAACCGCAAAATCATGGAG
TCCCATATTCTATAACCGAAGATTTCACCAGCGTCTATCGAATGCACTCGCTCTTACCTGATCAGCTCGAACTACGTGAC
ATCGACGTTGTACCAGGAACTAATAAATCACTACCGTTGATTGAAGAGGTTTCTTTCGGAAAATTGCTTGGTCCTAAGGG
AGAACAAACCATGTCTCATATTGGATTTACTAAGCTAATGGTCTCAATGGGTCATCAAGCAAGTGGGGCTCTCGAACTGA
TGAATTATCCAGTGTGGCTTAGGGATCTTGTTCCCCACGACCCCAATGGCTACGATCGTCCGGACCACATCGACTTAGCT
GCTTTAGAAATCTACAGGGACAGGGAGAGGAATGTTGCACGATACAATGAATTTAGGAGGTCTATGTTTATGATTCCGAT
AAAGAAGTGGGAAGATCTAACGGACGATAAGGAAGCAATTGAAGCACTAGAAGACGTGTACGGTGGTAATGTGGAAGAGC
TCGATCTTCTGGTGGGACTTATGGCCGAGAAGAAAATCAAAGGATTCGCTATTAGCGAGACTGCCTTTAACATTTTCGTC
ATCATGGCTACAAGGAGATTAGAAGCGGATAGATTCTTCACGAGTGATTTCAATGAAATGACTTATACAAAGAAAGGACT
TGAATGGGTGAATACTACAGAGAGTCTCAGAGACGTTTTTGATCGCCATTATCCTGAGATGACCGACAGATGGATGAACT
CTGAAAGTGCATTTTCAGTATGGGATTCACCACCGGTTGCCAAAAACCCAATCCCTCTCTATCTCCGAGTTCCATCATCT
TAA