Details for Kale Locus Bo5g155150

Position : C5 ( 5`- 46713527 .. 46714556 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155150

Protein [Map View]
MDAQTQNTSLQRLQNVERRVVRVLDIAGGVMEELTNPSGPRRDLVKTLCGEFMQSIKDIQVTLREEIKSACEYRPFEKCD
YNSRIANEICFHKLQYVLSQLDHLQITVGRYPSSD*

DNA
ATGGATGCGCAGACGCAGAACACATCGTTGCAGCGACTCCAGAATGTGGAGAGGAGAGTGGTAAGGGTGTTGGATATAGC
GGGAGGAGTAATGGAAGAACTGACGAACCCTTCTGGGCCCAGGAGAGATTTGGTCAAGACTCTTTGCGGAGAGTTCATGC
AATCCATCAAGGATATACAAGTGACACTAAGGGAAGAGATCAAAAGCGCCTGCGAGTACCGCCCCTTTGAGAAATGCGAC
TACAATTCAAGGATAGCTAATGAGATCTGCTTCCACAAGCTTCAATACGTTCTCTCTCAGCTTGATCATCTTCAAATAAC
TGTTGGCCGCTATCCTTCTTCGGATTGA