Details for Kale Locus Bo5g155140

Position : C5 ( 5`- 46712408 .. 46713129 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155140

Protein [Map View]
MSLGFAVSIALTGALGESNVSLAKDNGFWIDGPLPTPPIYNNIVNEQTGTRSFLKKGVYVADIGTKGRTYRVKKYAFDLL
AMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISVAASQDKQPLTDLANRLFDNFEKLEDAAKRKNLAETEACYKDTKLI
LQEVMIRMA*

DNA
ATGTCATTGGGATTTGCTGTCTCCATAGCTCTAACTGGAGCTCTCGGCGAAAGTAATGTTTCCTTGGCAAAAGACAATGG
CTTTTGGATCGATGGTCCTCTTCCAACTCCTCCTATTTACAACAATATCGTGAACGAGCAGACAGGGACGAGATCGTTCT
TGAAGAAAGGAGTGTATGTAGCGGACATCGGGACCAAAGGAAGAACGTATAGAGTTAAAAAGTATGCTTTCGATCTCTTG
GCTATGGAGGACTTGATCGGACCAGACACGTTAAACTATGTTAAAAAGTACTTGAGGCTTAAATCCACCTTCTTGTTCTA
CGATTTCGACAATCTCATCTCTGTTGCTGCCTCCCAAGACAAGCAGCCTCTCACTGATTTGGCCAACAGATTGTTCGACA
ACTTTGAAAAGCTTGAAGATGCAGCTAAAAGGAAGAACTTAGCTGAGACAGAAGCGTGTTATAAAGATACAAAGTTAATT
CTTCAAGAGGTTATGATCAGAATGGCATGA