Details for Kale Locus Bo5g155120

Position : C5 ( 5`- 46700857 .. 46702082 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155120

Protein [Map View]
MESNKFFFNPSTSHGNMFFLGNLNPVVQGSMMNMEESSSKRRPFFCSPDDLLYDDVDVDYYDDHTPDKKRRLTHEQVHLL
EKSFEKENKLEPERKTQLANKLGLQPRQVSVWFQNRRARWKTKQLERDFNLLKSSYDQLLSNYDSILKDNHLLRSQVTSL
AGKVQAKAETAPYQVPESNQLDPVNMNRFEPAIKTEDRLSSGSAVLDEDAPHQLRDSCDSYFPTIVPIHHSAEEHNNGSG
NDTGCFADVFVQGESFGFWGWT*

DNA
ATGGAATCCAATAAGTTTTTCTTCAATCCGTCTACTTCTCATGGTAACATGTTCTTCCTCGGTAATCTCAATCCCGTGGT
CCAAGGATCGATGATGAACATGGAGGAATCATCATCAAAGAGAAGACCCTTCTTTTGCTCCCCCGATGATCTCCTCTACG
ACGACGTCGACGTCGACTACTACGACGATCACACACCCGACAAAAAGCGTCGCCTTACTCATGAACAGGTGCATCTGCTG
GAGAAGAGCTTCGAGAAGGAGAACAAGCTGGAGCCAGAGCGCAAGACTCAGCTTGCCAACAAGCTTGGTCTTCAGCCCAG
GCAAGTCTCCGTCTGGTTTCAAAACCGCCGCGCTCGTTGGAAAACCAAGCAGCTCGAGAGAGACTTCAATCTCCTCAAGT
CCTCTTACGACCAGCTCCTCTCTAACTACGACTCCATCCTCAAGGACAACCATCTCCTCAGATCCCAGGTGACTTCCCTA
GCCGGCAAGGTCCAAGCCAAAGCAGAGACAGCTCCTTATCAAGTACCCGAATCAAACCAGCTCGATCCGGTGAACATGAA
CCGGTTCGAACCGGCAATCAAAACAGAGGATCGGTTAAGTTCAGGGAGTGCGGTACTAGACGAAGACGCACCTCATCAAC
TAAGAGACAGCTGCGACTCTTACTTCCCAACCATTGTACCCATCCACCACTCGGCGGAGGAACATAACAACGGCAGTGGT
AATGACACTGGCTGTTTCGCTGACGTCTTTGTGCAAGGTGAATCATTTGGATTCTGGGGCTGGACTTGA