Details for Kale Locus Bo5g155110

Position : C5 ( 5`- 46685312 .. 46687345 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155110

Protein [Map View]
MMAASFATLPTLSLVNTSRRRIDSYSSKKRVGVVRCCSGGDIPEYKQVQRGGGGGTLKECAITLALSLGMIAGGGAPSIA
YAANPAIPQVSVLISGPPIKDPGALLRYALPIDNKAIRQVQKPLEDITDSLKIAGVKALDSVERNVRQASRSLQQGKSMI
VAGFAESKKDHGHELIGKLEAGMQDMLQIVEDRKRDAVAPKQKEILQYVGGIEEYMVDGFPYDVPEEYRNMPLLKGRATV
DMKVKIKDNPNLEDCVFRIVLDGYNAPVTAGNFVDLVERHFYDGMEIQRSDGFVVQTGDPEGPAEGFIDPSTEKVRTVPL
EIMVEGKKTPFYGSTLEELGLYKAQVMLPFNAFGTMAMARDEFENDSGSSQVFWLLKESELTPSNSNILDGRYAVFGYVT
QNEDFLADLKVGDVIESIQVVSGLDNLVNPSYKIAG*

DNA
ATGATGGCGGCATCGTTTGCCACTCTCCCTACATTGAGTTTGGTCAATACGTCGAGAAGGAGAATCGATTCTTACAGCTC
CAAAAAACGCGTCGGAGTTGTTCGTTGTTGCTCCGGCGGCGACATTCCCGAATATAAGCAGGTGCAGAGAGGAGGAGGAG
GAGGGACATTGAAAGAATGTGCGATTACATTAGCTTTATCGTTGGGTATGATAGCTGGAGGAGGAGCACCTTCGATTGCT
TACGCGGCGAACCCAGCGATTCCACAAGTCTCAGTGTTGATCTCTGGCCCTCCCATCAAAGACCCAGGAGCTTTGTTGAG
ATACGCATTGCCCATCGACAACAAAGCCATCAGACAAGTGCAGAAGCCTCTCGAGGACATCACTGACAGCCTCAAGATCG
CTGGCGTTAAGGCTCTCGATTCTGTTGAACGTAATGTTAGGCAAGCAAGTAGATCACTCCAGCAAGGGAAAAGCATGATT
GTTGCCGGTTTTGCTGAGTCGAAGAAGGATCATGGTCACGAACTGATTGGGAAATTGGAAGCTGGTATGCAAGACATGCT
ACAGATTGTGGAAGATCGCAAAAGAGATGCGGTTGCTCCTAAACAGAAAGAGATTCTCCAATATGTTGGCGGAATTGAAG
AGTACATGGTTGATGGCTTCCCTTATGATGTCCCTGAGGAGTACCGCAACATGCCTCTTCTCAAGGGAAGAGCCACTGTC
GACATGAAGGTCAAGATCAAGGACAACCCCAACCTCGAGGATTGTGTTTTCCGCATTGTCCTCGATGGCTACAACGCCCC
TGTCACCGCCGGCAACTTTGTGGACTTGGTGGAGCGCCATTTCTACGATGGCATGGAGATCCAGAGATCTGATGGGTTTG
TGGTACAAACGGGAGATCCAGAGGGTCCTGCGGAAGGATTTATAGATCCAAGCACAGAGAAAGTGAGGACTGTTCCTCTT
GAGATTATGGTGGAAGGGAAGAAGACTCCCTTTTACGGCTCAACCCTTGAAGAATTGGGTCTGTACAAGGCTCAGGTGAT
GCTTCCATTCAACGCATTTGGGACTATGGCAATGGCTAGAGACGAGTTTGAGAATGACTCGGGATCGAGCCAAGTGTTTT
GGCTGCTGAAAGAGAGTGAGCTGACGCCAAGCAATTCCAACATCTTGGACGGTCGTTACGCTGTCTTCGGTTACGTTACT
CAGAATGAAGACTTTCTTGCTGATCTTAAAGTCGGTGATGTCATTGAGTCCATCCAAGTTGTCTCCGGTTTAGACAACCT
CGTCAACCCCAGTTACAAAATCGCCGGATAG