Details for Kale Locus Bo5g155090

Position : C5 ( 5`- 46676709 .. 46680502 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155090

Protein [Map View]
MATAPLSGFFLTSLSPSQPSLQKQTLRSSPTVACLPSSSSSSSSSSSRSVPTLIRNEPVFAAPAPIITPYWSEEMGSEAY
EEAIEALKKLIIEKEELKTVAAAKVEQATAALQTGTSSDKKAFDPVENIKQGFITFKKEKYETNPALYGELAKGQSPKYM
VFACSDSRVCPSHVLNFQPGEAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDG
NNSTDFIEDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVREGLVKGTLALKGGYYDFIKGAFEL
WGLEFGLSETSSVKDVATILHWKL*

DNA
ATGGCGACCGCTCCTCTCTCCGGCTTCTTCCTCACCTCTCTTTCTCCTTCTCAACCTTCTCTCCAAAAACAAACTCTTCG
TTCTTCTCCCACCGTTGCTTGCCTTCCCTCATCCTCCTCCTCCTCCTCCTCCTCCTCCTCTCGTTCCGTTCCAACACTTA
TCCGTAATGAGCCCGTTTTTGCCGCTCCTGCTCCTATCATCACCCCTTACTGGAGCGAAGAGATGGGTAGCGAAGCATAC
GAAGAGGCCATTGAAGCTCTCAAGAAGCTTATTATCGAGAAGGAGGAGCTAAAGACTGTTGCGGCCGCTAAGGTGGAGCA
GGCCACGGCAGCACTTCAGACAGGTACTTCCTCCGACAAGAAAGCTTTCGACCCCGTCGAAAACATTAAGCAAGGCTTCA
TCACTTTCAAGAAGGAGAAATACGAAACCAACCCTGCTTTGTACGGTGAGCTCGCCAAGGGTCAGAGTCCTAAGTATATG
GTGTTTGCTTGTTCCGACTCGCGTGTGTGTCCATCGCACGTTCTCAACTTTCAGCCAGGAGAGGCCTTCGTTGTCCGTAA
CATAGCCAACATGGTTCCTCCTTTTGACAAGGTCAAATACGGTGGAGTTGGAGCAGCCATCGAATACGCTGTTTTGCACC
TTAAGGTGGAGAACATTGTGGTGATAGGACACAGCGCTTGTGGTGGGATCAAGGGACTTATGTCTTTTCCTTTGGATGGA
AACAACTCCACTGATTTCATAGAGGACTGGGTCAAAATCTGTTTACCAGCCAAGTCAAAAGTCATATCAGAACTTGGAGA
TTCAGCCTTTGAGGACCAGTGTGGCCGATGTGAAAGGGAGGCAGTGAATGTTTCACTAGCAAACTTGTTGACCTATCCAT
TCGTGAGAGAAGGACTTGTGAAAGGAACCCTTGCTTTGAAGGGAGGTTACTATGATTTTATAAAGGGTGCTTTTGAGCTT
TGGGGACTTGAGTTTGGCCTCTCCGAAACTAGCTCAGTTAAAGATGTGGCTACCATACTACATTGGAAGCTGTAG