Details for Kale Locus Bo5g155080

Position : C5 ( 5`- 46673798 .. 46674633 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155080

Protein [Map View]
MEEFSPTVSCSPSFSFYASSECADAAAKVSRENQSYNITDQYSVKVNSVDDFQLETSSPLHEETFVHFPTFKPVSSDTVS
MIRKKDVDAGIVPEEVRWSTPPSPLRSESEELDKFSGNCLWKLSTLEGGTEKAQNGGS*

DNA
ATGGAGGAGTTTTCCCCAACGGTATCGTGCAGCCCAAGCTTCAGCTTCTACGCTTCCAGCGAATGCGCCGATGCCGCCGC
TAAAGTTTCCCGCGAAAACCAGAGTTACAATATAACAGATCAATATTCGGTTAAAGTTAACTCCGTCGATGACTTCCAGT
TGGAAACATCATCACCCTTACATGAAGAGACCTTCGTCCACTTCCCGACGTTCAAACCAGTGTCCAGCGACACCGTTTCA
ATGATTAGAAAGAAAGACGTTGATGCTGGAATTGTCCCGGAGGAAGTAAGATGGAGCACTCCGCCTTCGCCTTTAAGGTC
GGAATCTGAAGAATTGGATAAATTCTCCGGAAATTGTCTATGGAAATTGTCTACACTCGAAGGTGGAACTGAAAAAGCTC
AAAACGGTGGGAGTTGA