Details for Kale Locus Bo5g155070

Position : C5 ( 5`- 46664659 .. 46665204 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155070

Protein [Map View]
MEEENQKTHRSVSRKDRSHGADEEAAPGDKCSGERCRSSWAAAAIADCVALCCCPCAVVNLLTLAFVKVPWMIGRKCIGR
RKKRKKKIEREDRFHHNQRPETVKGVSGGCCGGGYGEWDDHRFVVERDGSLTKEEEEKTASFRGEGEARISARDEAERVW
LELYQIGHLGFGRVSFTGIHQ*

DNA
ATGGAAGAGGAAAACCAAAAAACACATCGATCAGTTTCACGTAAAGACCGGAGTCATGGCGCCGACGAAGAAGCAGCGCC
AGGAGACAAATGCTCCGGTGAAAGGTGCCGGTCTTCGTGGGCTGCGGCGGCGATAGCAGACTGTGTGGCGCTTTGCTGTT
GTCCCTGCGCCGTCGTGAACCTCCTCACACTTGCCTTCGTCAAGGTCCCGTGGATGATTGGGCGGAAATGCATCGGACGG
AGAAAGAAGAGGAAGAAAAAGATAGAGCGTGAGGATCGTTTTCATCACAACCAGAGGCCGGAGACGGTAAAAGGCGTGAG
TGGTGGATGTTGCGGCGGAGGATATGGAGAGTGGGATGACCACCGGTTTGTGGTGGAGAGAGATGGAAGTCTAACGAAGG
AGGAGGAGGAGAAAACGGCGAGTTTTAGGGGAGAGGGTGAGGCGAGGATCAGTGCGAGAGATGAAGCTGAGAGAGTTTGG
TTGGAATTGTATCAGATTGGACATCTTGGCTTCGGTAGAGTCTCTTTCACTGGTATTCATCAGTAA