Details for Kale Locus Bo5g155060

Position : C5 ( 5`- 46662592 .. 46663621 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155060

Protein [Map View]
MEREPTRVMVAVNESTIKGKPHPSISSKRAFEWTLEKMVRSNASDFKILLLHVHVVDEDGFDEVDSIYASPDDFKDMRES
NKSKGLHLLEFFVNKCHEFGVSCEAWIKKGDPKDVICQEVSRVRPDLLVLGSRGLGRFQKVFVGTVSGFCVKHAECPVLT
IKRNADETPSDLADD*

DNA
ATGGAGAGGGAGCCGACACGAGTGATGGTGGCTGTGAACGAATCGACGATCAAAGGGAAGCCTCACCCTTCGATAAGCAG
CAAAAGAGCTTTCGAATGGACTCTGGAGAAGATGGTCCGATCCAACGCATCCGATTTCAAGATTCTCTTGCTCCATGTAC
ATGTGGTCGACGAAGACGGTTTTGATGAGGTAGACAGCATATATGCGTCTCCTGATGATTTCAAAGACATGAGAGAGTCT
AACAAGTCTAAAGGTCTTCACCTTCTCGAGTTTTTCGTTAACAAATGTCACGAGTTTGGGGTTAGTTGCGAGGCTTGGAT
CAAGAAAGGTGATCCCAAGGATGTGATCTGCCAAGAAGTCAGCCGGGTCCGACCAGATCTTCTTGTTTTGGGAAGCCGTG
GTCTTGGCCGCTTCCAAAAGGTCTTTGTTGGGACGGTGAGTGGGTTCTGTGTGAAACATGCTGAGTGTCCGGTCCTCACG
ATCAAACGCAATGCCGATGAAACTCCCAGTGATCTTGCTGATGACTAA