Details for Kale Locus Bo5g155050

Position : C5 ( 5`- 46660812 .. 46661980 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g155050

Protein [Map View]
SKLYISLSVSVSSHLLCSIFISHTKIQNKITRKKKMDKKKTGIRKERIPAQKEEEGTVRKGPWTMEEDLILFNYILNHGE
GLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNITAEEQLLIIQLHAKLGNRWSKIAKYLPGRTDNEIKNFWRTKIQR
HVKFSSSVNTINTRHCSGNSQSSVITATDQGSSSKGFDMAESLISPATTTTSFHMMEQSNDSYWNVEDLWPLQLLNGDHQ
VI*

DNA
AGTAAACTGTATATATCTCTCTCTGTCTCTGTATCCTCGCATCTTCTCTGTTCTATCTTTATTTCACATACAAAAATACA
AAACAAAATAACTAGAAAGAAGAAGATGGATAAGAAGAAGACAGGGATAAGGAAAGAGAGAATACCAGCACAGAAAGAAG
AAGAAGGAACAGTGAGGAAAGGACCATGGACTATGGAAGAAGATTTGATCCTCTTTAATTACATCCTTAATCATGGTGAA
GGTCTTTGGAACTCCGTCGCCAAAGCCTCTGGTCTAAAACGTACGGGGAAAAGTTGTCGGCTCAGGTGGCTGAACTATCT
CCGGCCAGATGTGCGGCGAGGGAACATAACAGCAGAAGAACAGCTTTTGATCATTCAACTTCATGCTAAGCTTGGAAACA
GGTGGTCGAAGATTGCGAAATATCTTCCAGGGAGAACGGACAACGAGATAAAGAATTTCTGGAGGACAAAGATTCAGAGA
CACGTGAAATTTTCTTCGTCGGTAAATACTATTAATACTCGTCATTGTTCGGGAAACTCGCAGAGCTCGGTGATAACAGC
GACGGACCAAGGCAGCTCTAGCAAAGGCTTCGATATGGCTGAGAGCTTAATCTCGCCGGCGACGACAACGACATCGTTTC
ATATGATGGAACAGTCAAACGACAGTTACTGGAACGTTGAAGATCTATGGCCCCTGCAGTTGCTTAATGGTGACCACCAA
GTGATTTAA