Details for Kale Locus Bo5g154020

Position : C5 ( 5`- 46611070 .. 46611983 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g154020

Protein [Map View]
MDSLQFNLQQSPFQLRPRRTIRPRITNISNQTEETDPRPPSSAGKIQRLVLNNEGRTKLNAGPDREFYSYPRFVNHVDDG
FISSLTDLYRNRLRSGSIVLDLMSSWVSHLPEEVKYERVVGHGLNAQELARNPRLDYFFVKDLNEDQKLEFQDKYFDAVL
CSVGVQYLQQPEKVFAEVYRVLKPGGALIVSFSNRMFYEKAIRVWRDGTEYGRVQLVVQYFQSVQGFTQPETIRQQPPPG
GGAEKPVLNWFMGLIGLASRPDPFNAVIAYKNFKPLYE*

DNA
ATGGATTCTCTTCAATTCAACCTTCAGCAATCTCCCTTTCAGTTGAGACCCAGAAGAACTATTCGACCAAGAATCACTAA
CATTTCGAACCAAACCGAAGAAACCGATCCGCGACCACCATCCTCGGCCGGTAAGATCCAACGGTTAGTACTCAACAATG
AAGGTCGTACTAAACTCAACGCCGGTCCTGACCGCGAATTCTATTCATACCCACGATTCGTGAACCACGTCGACGACGGT
TTCATATCCTCCTTAACGGATCTCTACAGAAACCGGTTAAGATCCGGTTCGATTGTGTTAGACCTGATGAGCTCATGGGT
TAGCCATCTACCAGAAGAGGTGAAGTACGAGAGAGTAGTGGGACATGGTCTTAACGCACAGGAGCTTGCCAGAAACCCTA
GACTCGATTACTTCTTCGTCAAGGATCTTAACGAGGATCAGAAACTCGAATTCCAAGACAAATATTTCGATGCGGTTTTA
TGTTCTGTCGGTGTACAGTATCTACAACAACCCGAAAAGGTGTTTGCGGAAGTGTATAGAGTGTTGAAACCGGGAGGTGC
GTTGATAGTGAGTTTTAGCAATCGGATGTTTTATGAGAAAGCAATCAGGGTTTGGAGAGATGGAACCGAGTACGGTCGGG
TGCAACTGGTGGTTCAGTACTTTCAATCTGTCCAAGGGTTTACTCAGCCGGAGACCATCCGGCAACAGCCTCCTCCTGGT
GGAGGAGCTGAGAAACCGGTTTTGAATTGGTTTATGGGTTTAATTGGTTTGGCTTCTAGGCCGGACCCTTTTAATGCTGT
GATTGCTTATAAGAATTTCAAACCTCTGTATGAGTAA