Details for Kale Locus Bo5g154000

Position : C5 ( 5`- 46601710 .. 46604862 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g154000

Protein [Map View]
MESLIKSQHAQKQAGHSGKAPGTEIIPATTGLTMSSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRATLDSDDSN
ASMLPLPTDDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMSVFEHLSSYHWDGKLVLTLAAFALNYGEFW
LLVQFYSKNQLAKSLAMLKLVPVQNRVTLESVSQGLNDLIREMKSVTACVVELSELPGRYITLDDPQLSRIISTIPIAVY
WTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHLAETLRLCYRHIEKQRSSESLKMLHSLFDTTHID
NMKILTALIHPKNHTMPLQDGLTKRKVHLDVLRRKTVLLLISDLNILQDELSIFEQIYTESRSSLLGADGKSHMPYEVVW
VPIVDPIEDYERSPSLQKKFEALRAPMPWYTVDSPKLVERHVVEFMRERWHFMNKPILVVLDPQGNEASLNALHMIWIWG
TEAFPFTRAREEELWRRETFTLNLIVDGIDAVIFNWINPGNYIFLYGGDDLDWIRRFTMAAKATAKDSDVKLEMAYVGKR
NHSHREQIRRISEAVRAENLSHSWAEPALMWFFWARLESMLYSKIQLGKSDDHDEVMQGIKKILSYDKLGGWALLSKGAE
IVMITHGVIERTVTVYDRTWKTHVPTKGYSKAMYDHHHDEVLRETGHPCAHFDFHITARSGRIPEKMNCFECHRPMEKYM
SFACCHDEKLLDQDENYNF*

DNA
ATGGAGTCACTGATCAAGTCCCAGCACGCTCAGAAACAAGCTGGCCACAGTGGTAAAGCTCCGGGTACGGAGATTATACC
GGCGACGACGGGACTAACGATGTCATCGGACGAGAGCATGATGCTGAAGCTGATCCAACAAACACACTCCCCTGATGCTC
GCGAAGTCCAAGTGCGTGGCCTTCTCTCTCTCGTTGAAGATATTCTCGATCGTGCCACTCTTGACTCCGACGACTCCAAC
GCCTCCATGCTCCCATTGCCTACGGATGATAAACTGATGCAATCAAGCATGATGAGCGTTCTTGATAGCGTCTCATATGC
TATCGATCGCGTCGCCTGCGAGATAGCCTACAAGTCTCTGACCGGATCAGACGCACATGAAATAACAATGTCAGTGTTCG
AACACCTCTCGAGCTACCACTGGGACGGCAAGCTAGTCCTGACTCTAGCCGCGTTCGCCTTGAACTATGGAGAATTTTGG
CTTCTGGTCCAGTTCTACTCAAAGAATCAGCTGGCTAAATCCCTAGCTATGCTAAAGCTCGTCCCTGTTCAGAACAGAGT
GACCCTCGAGTCTGTATCCCAAGGGCTCAACGATCTCATCCGTGAGATGAAGAGCGTCACCGCATGTGTAGTGGAACTCA
GTGAGTTACCTGGTCGCTACATTACACTGGACGATCCTCAGCTGTCGAGAATCATCTCTACCATCCCAATCGCTGTCTAT
TGGACCATAAGAAGCATCGTGGCTTGCATTTCTCAAATCAACATGATCACTGCCATGGGACACGAGATGATGAACACTCA
AATGGATTCATGGGAAACGTCCATGTTAGCTAACAAGCTCAAGAACATTCATGACCATCTCGCCGAGACCTTGAGGCTTT
GCTACCGTCACATAGAGAAGCAGAGGAGCTCAGAATCCTTAAAGATGTTGCATTCTCTATTCGACACAACACACATTGAT
AACATGAAGATTCTCACGGCCCTCATTCATCCTAAAAACCACACCATGCCATTGCAAGATGGTTTAACCAAGAGAAAGGT
TCACTTGGACGTGTTGAGGAGGAAGACAGTGTTGTTGCTGATATCTGACCTCAACATATTGCAAGACGAGCTATCGATAT
TCGAGCAAATCTACACAGAATCAAGGAGCAGCTTGTTGGGAGCTGATGGTAAGAGTCATATGCCGTACGAGGTTGTGTGG
GTTCCGATAGTGGATCCTATCGAAGATTACGAAAGATCACCGAGTCTGCAGAAGAAATTCGAGGCTCTCCGTGCACCTAT
GCCATGGTACACAGTGGATAGTCCAAAGCTGGTAGAGAGACATGTGGTGGAGTTTATGAGAGAGAGATGGCATTTCATGA
ACAAGCCAATACTTGTGGTGCTTGACCCACAAGGCAACGAGGCTAGTCTCAATGCGCTTCACATGATCTGGATTTGGGGG
ACTGAAGCTTTCCCTTTCACTAGAGCTCGTGAGGAAGAGCTATGGAGGAGGGAGACTTTTACCCTTAACCTCATCGTCGA
TGGCATCGACGCTGTCATTTTCAACTGGATAAATCCGGGAAATTACATATTCTTGTACGGAGGAGATGACTTGGACTGGA
TAAGAAGGTTCACAATGGCGGCCAAAGCAACGGCTAAAGATTCCGACGTGAAGCTGGAGATGGCTTATGTTGGTAAACGG
AACCACAGCCACAGAGAACAGATCAGGCGGATCAGTGAAGCCGTCAGGGCTGAAAATCTGAGTCACAGCTGGGCCGAGCC
TGCATTAATGTGGTTCTTCTGGGCTAGGCTCGAGAGCATGCTCTACTCCAAAATTCAACTCGGTAAATCCGATGATCACG
ATGAGGTGATGCAAGGAATCAAGAAGATACTGAGCTACGACAAGCTTGGAGGATGGGCACTGCTGAGCAAAGGAGCTGAG
ATAGTGATGATAACTCACGGTGTCATTGAGAGGACTGTCACCGTCTACGACCGAACCTGGAAAACTCACGTCCCGACCAA
AGGCTACAGCAAGGCAATGTACGACCACCATCATGACGAGGTTCTCAGGGAAACCGGACATCCATGCGCTCACTTTGATT
TCCACATCACTGCTCGGAGCGGTCGGATTCCAGAGAAGATGAACTGCTTCGAATGCCACCGTCCCATGGAGAAGTACATG
AGCTTCGCTTGTTGTCACGATGAGAAGCTCCTTGACCAAGACGAGAACTACAACTTCTAG