Details for Kale Locus Bo5g153970

Position : C5 ( 5`- 46587836 .. 46588252 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g153970

Protein [Map View]
MARQFIVFALLALAVATAFAADAPSAAPTASPTKAPTTQTKVPASAPKTSSSAPAPKASSPVAEEPTPEDDYSATSPSDS
AEGPTVSSPPAPTPESTSADGPSSDAPTAESPQSGAVTNVKLSIAGTVAAVGFFFFSL*

DNA
ATGGCACGTCAATTTATCGTTTTTGCCCTTTTGGCTTTGGCTGTGGCCACCGCTTTCGCTGCCGACGCACCTTCAGCTGC
ACCCACTGCTTCTCCGACCAAAGCACCCACCACCCAAACCAAGGTTCCCGCCTCCGCACCCAAAACCTCCTCCTCCGCCC
CCGCACCCAAAGCATCGTCCCCTGTCGCAGAGGAACCAACCCCCGAAGATGATTACTCGGCAACCAGCCCCAGTGACTCT
GCCGAGGGACCCACCGTATCCTCCCCACCGGCTCCTACCCCGGAAAGCACCTCCGCCGATGGACCATCATCTGACGCACC
CACCGCCGAGTCACCCCAAAGCGGCGCCGTAACCAATGTGAAGCTCTCTATCGCCGGCACTGTCGCCGCCGTTGGATTCT
TCTTCTTCTCTCTCTAA