Details for Kale Locus Bo5g153940

Position : C5 ( 5`- 46579865 .. 46580290 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g153940

Protein [Map View]
MKSNKREEYHQRVFSCFDKTQQGKVSVSAIERCVDAIKSGEKAVPEEDTTDSPHTDKSLELEEFVKLVEQGAEEDKERDL
KQAFNMMFEESLQGITPKSLKRMLSLLGESKSLEECEVMVSQFDINRDGIISFDEFRVMMQ*

DNA
ATGAAGAGCAACAAACGTGAAGAGTATCATCAAAGGGTGTTTAGTTGCTTTGACAAGACCCAACAGGGGAAGGTTTCTGT
TTCCGCCATCGAGAGATGTGTGGATGCTATTAAGTCCGGGGAAAAGGCCGTACCAGAAGAAGACACGACCGATTCACCAC
ACACTGATAAATCCTTGGAACTCGAGGAATTCGTGAAGCTGGTGGAACAAGGAGCAGAGGAAGACAAGGAGAGGGACTTG
AAGCAGGCTTTCAACATGATGTTTGAAGAGAGTCTACAAGGCATTACTCCTAAAAGTTTGAAGAGGATGCTAAGTTTGTT
GGGTGAGTCTAAAAGCCTTGAAGAATGCGAGGTTATGGTCTCGCAATTTGATATTAATAGGGATGGAATTATTAGTTTCG
ATGAGTTTAGGGTCATGATGCAATAA