Details for Kale Locus Bo5g153930

Position : C5 ( 5`- 46577942 .. 46579846 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g153930

Protein [Map View]
MAGSVSKECVTSLIMFFFTWSLCATSNDLLSCDPEESSSSSSASYVCHSNLQKCRTFATLRANSPLRGHFIPIDCTCNGR
FYEAHLFKTCVKGDTFRPVAASLQGQLTTCLSLRDEVSEESLDEKVKLRLGVKCSCPEEGATRFLVTYPVSEGESVSSLA
DKFNTTEDAIVSANNNSGVVPRTPALIPLDHKPQNTTPSRQKKKRSKMKIAVISAIAGVMGLITLMVLGYLHWKKETRLQ
SWISNKDPETRQLSLSIRTTSDKKISFEGSQELDSVVVVGTTTPRKPVVEIYALEELEKATENFSSSNHIKGSVYFGSLK
GKDLAIKQVSAGVMKRFDLGLLNDQSHYYSHNLMRVLGTCFRESPPDEGASYLVFEYAKNGSLWDWLQNKLAIKNQFIES
CYCFLAWKQRIKICHDVAIALKFMHRINYVHGNITSRNIFLNEDLRGKVGNFGMSSKDDNIGSSMSPATDVFSYGIIVME
VLSGQTSEMLLGPQEQEEEEENRVNPEWKRLRESFMMGEKEMLREVMDSTLGESYSVDSAYEMARLATDCTAEEAELRPS
AAEIVERVSRLVDEEEDEAVLIERDNTISESSYKPLVRKGDEC*

DNA
ATGGCTGGTTCAGTTAGTAAAGAGTGCGTGACAAGTCTTATAATGTTCTTTTTCACATGGTCTCTCTGTGCAACTTCAAA
TGATCTGCTTAGCTGCGACCCAGAAGAATCCTCTTCCTCCTCCTCAGCTAGCTACGTTTGCCACTCAAACCTCCAAAAGT
GCCGCACTTTCGCCACTCTAAGAGCCAATTCTCCCTTGAGGGGCCATTTTATCCCGATTGACTGCACATGTAATGGAAGG
TTCTACGAGGCTCATCTGTTCAAAACTTGCGTTAAAGGCGACACCTTTCGCCCTGTCGCTGCATCCCTACAAGGCCAGCT
GACCACGTGCCTGTCTTTAAGAGACGAGGTTTCGGAGGAGAGCCTGGACGAGAAGGTTAAGTTGCGGTTGGGGGTCAAGT
GTTCATGTCCAGAAGAAGGCGCCACCAGGTTTCTCGTTACATATCCGGTGAGTGAGGGCGAAAGCGTTTCAAGCTTGGCA
GACAAGTTCAACACAACAGAGGATGCTATTGTGTCTGCAAACAACAATTCTGGAGTGGTTCCACGCACCCCTGCTCTCAT
ACCTCTTGATCATAAACCACAGAACACCACCCCGAGTCGCCAGAAGAAAAAGCGGTCAAAGATGAAGATCGCTGTGATCA
GCGCGATTGCTGGAGTTATGGGTCTTATCACTCTGATGGTGTTGGGTTACTTGCACTGGAAGAAAGAGACGCGTCTGCAA
AGCTGGATAAGCAATAAAGACCCAGAGACGCGGCAGCTGAGCCTGAGCATCCGAACCACCAGTGACAAGAAAATCTCCTT
TGAAGGGTCACAGGAGTTGGATTCGGTTGTTGTTGTTGGCACCACAACTCCCCGAAAGCCCGTTGTGGAGATTTACGCGT
TGGAGGAGCTGGAGAAAGCCACTGAGAATTTCAGCTCAAGCAATCACATCAAAGGTTCCGTTTATTTCGGTTCTCTCAAA
GGCAAAGACTTGGCTATCAAGCAAGTGAGCGCCGGTGTAATGAAAAGATTCGACTTGGGGCTTCTCAACGATCAGTCACA
CTACTACAGTCACAACCTGATGAGGGTTCTTGGGACATGTTTCAGAGAATCCCCGCCGGATGAGGGTGCTTCTTATCTGG
TTTTCGAGTACGCAAAGAATGGGTCTTTGTGGGATTGGCTCCAGAACAAATTGGCCATCAAGAATCAATTCATCGAGTCT
TGTTACTGTTTCTTGGCATGGAAACAGAGGATCAAGATCTGCCACGATGTCGCCATCGCCTTAAAGTTTATGCATCGGAT
TAACTATGTTCACGGCAACATCACGAGTAGGAACATTTTCTTGAATGAAGATCTTAGAGGTAAAGTCGGAAACTTTGGCA
TGTCGTCAAAGGATGACAACATTGGTTCTTCCATGTCTCCAGCTACTGACGTCTTCTCTTACGGGATCATCGTAATGGAG
GTTTTGTCTGGACAAACCTCAGAGATGCTGCTTGGACCGCAAGAACAAGAAGAAGAAGAAGAAAATAGGGTTAATCCCGA
GTGGAAGAGACTGAGAGAGTCGTTTATGATGGGGGAGAAGGAAATGCTAAGGGAAGTGATGGATAGCACGCTGGGGGAGA
GCTATTCAGTTGATTCTGCCTATGAAATGGCAAGACTTGCAACAGACTGTACTGCTGAAGAAGCAGAGCTAAGGCCGAGC
GCGGCTGAGATTGTAGAGAGGGTTTCGAGATTGGTGGATGAAGAAGAAGACGAGGCAGTCTTAATAGAGAGAGATAATAC
CATTTCAGAGAGTTCTTACAAGCCTTTGGTAAGGAAAGGAGATGAATGCTAA