Details for Kale Locus Bo5g153910

Position : C5 ( 5`- 46565941 .. 46567419 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g153910

Protein [Map View]
MEALTLVLLPFLFLVVLILSTGKSLCLRNSITPKTYPVIGCLLSFYTNRNRLLDWYTELLTESPSGTVIINRLAARRTVV
TANPSNVEYILKTNFDNYPKGKPFTEILGDFLGGGIFNVDGNLWVKQRRLATHDFTPRSLREYVDVLRNEVEDELLSFLD
AAAQDYQPFDLQELLRRFTFNIVCIVFLGIDRCSLNPSSPVSEFDRAFQTAAAVSAGRGSAPLSFVWKLKRLVGFGSEKD
LRHAVQKVHSCVNEIIREKKINTKSDFLSRLIVAGESDEAVRDMVISVVMAGRDTTSAVTTRLFSLISCHKTTECELVNE
IRSVKDITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTAVRAGDRVTYFPYGMGRMEELWGKDWD
EFKPNRWFDSYDHKTRVLKKVNPFKFPVFQAGPRVCLGEEMAYLQMKYVVASMLHRFQFEPIGTDKPVFVPMLTAHMAGG
MRVRVRRRYGSR*

DNA
ATGGAAGCTTTAACTCTTGTTCTTCTTCCTTTTCTCTTCCTCGTGGTTTTGATACTCTCTACTGGAAAATCTCTTTGTCT
ACGTAACTCTATAACGCCGAAAACATACCCGGTTATCGGATGCTTACTTTCCTTCTATACGAACCGGAACAGGTTGCTGG
ATTGGTATACCGAGCTCCTAACCGAATCCCCAAGTGGGACAGTGATCATTAACCGCTTGGCTGCCCGGAGAACCGTGGTG
ACGGCCAACCCATCCAACGTCGAGTACATCCTCAAGACAAACTTTGATAACTACCCGAAAGGCAAACCCTTCACGGAGAT
TCTTGGAGACTTTCTCGGCGGCGGGATATTTAACGTTGACGGAAACCTCTGGGTAAAGCAGCGGAGACTGGCTACTCATG
ATTTCACCCCCAGGTCGCTGAGAGAGTACGTTGACGTTTTGAGGAACGAGGTCGAGGACGAGCTTCTGTCCTTCTTGGAT
GCTGCCGCCCAAGATTATCAACCCTTCGATCTCCAAGAGCTTCTCCGGAGATTCACTTTCAATATTGTCTGCATTGTTTT
CCTCGGGATCGATCGTTGCAGTTTAAACCCGTCGTCACCCGTTTCTGAGTTCGATCGAGCGTTTCAGACTGCGGCTGCCG
TTAGCGCTGGACGTGGTTCCGCACCGCTATCCTTCGTGTGGAAGCTTAAGAGACTGGTCGGTTTTGGATCTGAGAAAGAC
CTCAGACACGCTGTCCAAAAAGTTCACAGCTGCGTCAATGAGATCATTCGAGAGAAGAAGATCAATACCAAGAGCGATTT
TCTGTCGCGATTGATCGTCGCTGGAGAAAGCGACGAGGCTGTGAGAGATATGGTAATTAGTGTTGTAATGGCCGGGAGGG
ACACGACCTCGGCGGTCACCACACGCTTGTTTTCGTTGATCTCCTGTCACAAGACAACCGAGTGTGAGCTAGTTAATGAA
ATCAGATCGGTTAAGGATATAACCGGGGGCTTCGATTATGAATCACTGAAGAAACTGAGTCTGTTGAAAGCGTGCTTGTG
TGAAGTGATGCGATTGTATCCTCCGGTGCCTTGGGATTCCAAACACGCCCTAACCGATGACCGTTTACCAGACGGTACGG
CGGTGCGTGCGGGAGACCGGGTTACGTATTTTCCATATGGGATGGGGAGAATGGAGGAGCTTTGGGGGAAAGATTGGGAT
GAGTTTAAACCAAACCGATGGTTTGACTCTTATGATCATAAGACCAGAGTTTTGAAGAAAGTGAACCCTTTCAAGTTTCC
GGTTTTTCAAGCCGGTCCGAGGGTTTGTCTCGGAGAAGAGATGGCGTACCTGCAGATGAAGTACGTTGTGGCTTCCATGC
TTCACCGTTTTCAGTTTGAACCGATCGGTACGGACAAACCGGTTTTTGTGCCAATGCTCACGGCTCACATGGCTGGTGGG
ATGCGAGTCCGCGTTCGCCGGAGATATGGATCTCGATGA