Details for Kale Locus Bo5g153900

Position : C5 ( 5`- 46558607 .. 46558819 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g153900

Protein [Map View]
MGGADWGPVAVAVVLFVVLSPGLLFQLPARRRVLECGNMTTSGISILVHAILFFAIITILVIAIQIHIHI*

DNA
ATGGGAGGAGCTGACTGGGGTCCAGTGGCGGTAGCGGTGGTGCTGTTTGTAGTGTTATCTCCCGGACTTCTCTTTCAGCT
GCCGGCGAGGAGACGGGTGTTGGAGTGCGGCAACATGACCACGAGTGGCATATCCATACTGGTTCATGCCATCCTCTTTT
TCGCTATTATCACCATTTTGGTCATCGCCATTCAAATTCACATCCACATCTAG