Details for Kale Locus Bo5g153890

Position : C5 ( 5`- 46555330 .. 46555542 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g153890

Protein [Map View]
MGLDWGPVLMSVVFFILLSPGVLFQLPGKSKAVEFGGFQTSGPSIVIHTLLFFAFITISLIALNIHIYAA*

DNA
ATGGGGTTGGACTGGGGACCCGTGTTGATGTCGGTGGTTTTTTTCATATTGTTGAGCCCTGGAGTTCTGTTTCAGTTGCC
TGGAAAGAGCAAAGCGGTTGAGTTCGGTGGGTTTCAAACAAGCGGTCCTTCCATTGTCATACACACTCTCCTCTTCTTCG
CCTTCATCACCATCTCTCTCATCGCCCTTAACATCCACATCTACGCGGCCTAA