Details for Kale Locus Bo5g153870

Position : C5 ( 5`- 46551203 .. 46551720 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g153870

Protein [Map View]
MEDRSCQVLFPSSSVDHRLSGDQTQINTSSSLQQHNTNKEEKHKSKKKEREARFAFQTRSQVDILDDGYRWRKYGQKAVK
NNPFPRSYYKCTEKGCRVKKQVQRLSGDEGVVVTTYQGVHTHPVDTPSDNFHHILTQMHIFPPF*

DNA
ATGGAGGATAGGTCATGTCAGGTGTTGTTTCCATCTTCATCGGTTGATCATCGCTTGTCTGGTGATCAAACTCAGATCAA
CACGTCCTCCTCGTTACAGCAGCATAACACTAACAAAGAAGAGAAACACAAGAGTAAGAAGAAAGAGAGAGAAGCCAGGT
TTGCTTTCCAGACAAGAAGTCAGGTTGATATTCTCGATGACGGATACAGGTGGAGGAAGTACGGCCAAAAAGCTGTCAAG
AACAATCCATTCCCCAGGAGCTATTATAAGTGCACAGAAAAAGGATGCAGAGTGAAGAAGCAAGTGCAGAGGCTATCAGG
AGATGAAGGAGTGGTGGTTACCACTTACCAAGGAGTTCATACCCACCCCGTTGATACACCCTCCGATAACTTCCACCACA
TCTTGACCCAGATGCACATCTTCCCTCCCTTTTAG