Details for Kale Locus Bo5g152850

Position : C5 ( 5`- 46526816 .. 46527658 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152850

Protein [Map View]
MLRARGGTNAVVQVPNLSTNNLLQKFFIASNLFGHMDSEDREEAKKKDEEDDKDIELTLGLSLNGQFGTDPRSRKRKNSE
LGRSSSIPEGFIFDGQRSGDVYGGDMRQTVGRGVSDMFQLDRTRSLPVKTKAETKRKRSEKTMELMAFNAPPPTKENEEK
DCFLVPGSVDGRGKKGNTTNKESQKVSGMEKARYVLEDMPCVWTRDVGADGERVEGFLYWYGGNTEEVKIMCVCHGSFLY
PAEFVRHGRGTVSDISDNGGGDVITNPLRHIVVKLPSSSL*

DNA
ATGTTAAGAGCAAGGGGAGGCACAAACGCCGTCGTTCAAGTCCCAAATCTATCAACTAACAATCTTTTGCAGAAGTTTTT
CATCGCAAGCAACCTTTTTGGTCACATGGACTCTGAGGATCGGGAAGAAGCAAAGAAAAAAGATGAAGAGGATGATAAAG
ATATTGAGCTAACGTTAGGTCTTTCTCTGAATGGTCAGTTTGGCACGGATCCGAGATCGAGGAAAAGGAAGAACTCTGAA
CTGGGTCGATCTTCTTCCATACCTGAAGGTTTCATCTTCGACGGACAAAGATCCGGTGACGTTTACGGCGGAGATATGCG
GCAGACAGTGGGGCGTGGAGTTTCGGACATGTTCCAGCTGGATCGGACACGTTCTCTGCCTGTCAAAACGAAGGCGGAGA
CTAAGAGGAAGCGATCGGAGAAGACAATGGAGCTTATGGCATTTAACGCTCCTCCTCCGACAAAGGAAAATGAAGAGAAA
GATTGTTTTCTTGTCCCTGGTTCGGTCGACGGGAGGGGCAAAAAGGGAAATACGACGAATAAGGAGAGCCAGAAAGTTTC
TGGAATGGAGAAGGCGCGGTACGTTTTAGAAGACATGCCGTGTGTGTGGACGAGGGATGTCGGAGCGGACGGGGAACGAG
TGGAAGGGTTTCTGTACTGGTATGGAGGGAACACGGAGGAAGTGAAGATAATGTGTGTCTGCCACGGCAGCTTTCTTTAT
CCGGCAGAGTTCGTTAGGCACGGCAGAGGCACCGTGTCTGACATCAGCGACAACGGTGGTGGTGATGTTATTACTAACCC
TCTTAGACATATCGTTGTTAAACTACCTTCTTCTTCCTTGTAG