Details for Kale Locus Bo5g152840

Position : C5 ( 5`- 46519036 .. 46520416 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152840

Protein [Map View]
RVLIFTSKSIYLFLIFFFFSYSHFIHAFKKEKRNQILFSLYFSSLFSPSSSSSSYYSLYQIVKTLDLLFKLMTVQTQELN
TSVMNTGPWRDANDDVSGGTRTRRIVEEDSEEAVVVAVATSGKPVIKKPPTSISSSSSSWMKSKDPRIVRVSRAFGGKDR
HSKVCTLRGLRDRRVRLSVPTAIQLYDLQERLGLDQPSKAVDWLLNAAKEEIDELPPLPVSPETFSLFNHHQAFLNLSQP
PGQDSTQLGFKTNGCVEESNTTTSREETNNNHIGSYGTYQNMEQHQQQHTRFQADYPHHQHQLHSLVPIQSQFLVCPMTA
SSTTTTIQSLFPSSSSAGSRTMETTDPRQMVSHFQMPSMGSSSSSQNISTLYSLLHGGSNPMPSVQFNRK*

DNA
AGGGTTCTCATATTCACTTCCAAAAGCATCTACCTCTTTCTTATTTTCTTTTTCTTTTCATATTCTCATTTTATTCATGC
TTTTAAAAAAGAAAAACGGAATCAAATACTTTTTTCTCTCTATTTCTCATCCTTATTCAGTCCCTCTTCTTCATCATCAT
CTTATTACTCGCTTTATCAAATAGTAAAAACCCTAGATTTGCTGTTCAAGCTCATGACCGTTCAGACTCAGGAACTCAAT
ACTAGTGTTATGAATACCGGACCTTGGAGAGATGCAAACGACGATGTTTCGGGCGGGACTAGGACAAGACGTATAGTAGA
AGAAGATTCAGAAGAAGCTGTCGTCGTAGCCGTAGCCACCAGTGGCAAACCCGTAATTAAGAAGCCACCAACTTCGATTT
CTTCTTCTTCGTCGTCGTGGATGAAATCGAAGGATCCAAGGATTGTTAGGGTTTCACGTGCCTTTGGAGGCAAAGACCGT
CACAGCAAAGTGTGTACGTTGCGTGGTCTACGTGACAGACGCGTGAGATTATCAGTCCCCACGGCTATCCAACTTTATGA
TCTTCAAGAACGGCTCGGCCTTGACCAGCCTAGCAAAGCCGTTGACTGGTTGCTCAATGCAGCCAAAGAGGAGATCGATG
AGCTTCCTCCCTTGCCCGTCTCGCCGGAAACTTTCAGTCTTTTCAACCATCACCAGGCGTTCTTGAATCTTAGTCAACCA
CCGGGTCAAGATTCGACCCAGCTCGGTTTTAAAACTAATGGATGTGTAGAAGAGTCCAATACTACTACTAGCCGTGAAGA
AACCAACAATAATCATATTGGGTCTTATGGAACCTATCAAAACATGGAACAGCATCAACAACAACATACGAGGTTTCAGG
CAGATTATCCCCATCATCAACATCAACTACATAGTCTTGTCCCAATTCAATCACAGTTCTTGGTATGTCCAATGACGGCA
TCATCAACAACAACTACTATACAATCTTTGTTTCCCTCATCATCATCAGCTGGTTCGAGGACTATGGAGACAACAGATCC
AAGGCAAATGGTAAGCCATTTTCAAATGCCATCAATGGGTAGTTCTTCATCTTCCCAAAACATTTCGACTCTCTACTCCT
TGTTGCATGGTGGTAGTAACCCGATGCCGTCGGTCCAGTTCAACCGGAAGTAG