Details for Kale Locus Bo5g152830

Position : C5 ( 5`- 46514769 .. 46515893 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152830

Protein [Map View]
MSNGVGEGGRAQSREKRKLFQANDFAYAIARMAVAQICESVEVNVYQESQTTREGLRFSSFQESALDKLASVAVEYVQSI
GKTAQLYANVAGRVEGNSLDVVQALEDLGSGVGFAGVSDTDRCLADSSVVKDVIRYTGEAEEVPFVYALPRFPVNKEKRL
APSFFEVGVVPPEEHIPVWLPAFPGTKSCHLSEEANAGAIEGEVASKENGPSLPSIQRSFNGGGLEVLKSPNDVGKSTEG
EEEVEGNPFLTAPLRFAEKEVSPVFRPLELSINHVSDKHMSNNHRIPVLESSTPSDGINKENGLAESEDGEKKDGARPQQ
TLLRFKIGTLKRPSCLAIKRSVQEQGWFQEGGDKREKKLGTERIDLGTVDSDVK*

DNA
ATGAGCAATGGAGTTGGGGAAGGTGGAAGAGCTCAGAGCAGAGAAAAGAGAAAGCTTTTTCAAGCCAATGATTTCGCCTA
CGCCATTGCAAGAATGGCTGTGGCTCAGATTTGCGAGAGTGTCGAGGTTAATGTCTATCAGGAATCACAGACAACACGCG
AGGGCCTTAGGTTTAGCTCTTTTCAAGAATCTGCTCTTGATAAGCTAGCCAGTGTAGCGGTTGAGTATGTCCAGAGCATT
GGGAAGACTGCTCAGCTGTATGCTAACGTAGCAGGTAGAGTAGAGGGTAATTCTCTGGATGTTGTTCAGGCGTTAGAGGA
TTTGGGATCTGGTGTGGGTTTCGCTGGTGTTTCGGACACTGACCGTTGTCTTGCTGATTCCAGTGTAGTCAAGGATGTTA
TTCGTTATACAGGAGAAGCGGAGGAGGTGCCGTTTGTTTATGCTCTCCCTCGTTTCCCAGTTAATAAAGAGAAAAGACTT
GCTCCTAGTTTCTTTGAGGTTGGAGTAGTCCCTCCAGAAGAACACATCCCCGTTTGGCTTCCTGCATTTCCCGGAACCAA
ATCTTGTCATCTATCAGAGGAAGCTAATGCGGGTGCAATCGAAGGAGAAGTTGCGAGTAAAGAAAATGGGCCATCGTTAC
CGAGTATACAACGTTCTTTCAATGGTGGTGGGTTAGAAGTACTCAAATCTCCAAATGATGTTGGAAAATCAACAGAAGGA
GAGGAAGAAGTGGAAGGTAATCCATTTCTTACCGCACCTCTTCGATTCGCGGAGAAGGAAGTGTCACCTGTGTTTCGTCC
TCTGGAGCTTAGCATCAACCACGTCTCTGATAAGCATATGAGCAACAACCACCGCATCCCAGTTCTTGAATCATCTACTC
CATCAGATGGTATCAACAAGGAGAACGGGTTAGCTGAATCCGAGGATGGAGAGAAGAAAGATGGTGCAAGACCACAACAG
ACTTTGTTACGTTTCAAGATTGGAACTCTGAAGAGACCTTCGTGTTTGGCTATAAAGAGGAGCGTCCAGGAACAGGGGTG
GTTTCAAGAAGGTGGAGACAAGAGGGAGAAGAAGTTAGGAACCGAAAGGATTGATTTGGGAACTGTCGACTCAGATGTAA
AATAG