Details for Kale Locus Bo5g152810

Position : C5 ( 5`- 46500096 .. 46500423 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152810

Protein [Map View]
MPSHKTFIIKKKLGKKMRQNRPIPGWIRLRTDNKIRYNAKRRHWRRTKLGF*

DNA
ATGCCGTCGCACAAGACGTTCATAATCAAGAAGAAGCTGGGGAAGAAGATGAGGCAAAACAGGCCTATCCCTGGCTGGAT
CCGTCTCCGTACCGATAACAAGATCAGGTACAACGCTAAGCGTAGGCATTGGCGCCGTACCAAGCTCGGGTTCTAG