Details for Kale Locus Bo5g152800

Position : C5 ( 5`- 46497578 .. 46499718 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152800

Protein [Map View]
MTTIVPTSEEDPFLSVVQFTSQLAWADAGPEAAEPEISRLCREAEESIVAGKWLELASLMVTSAELVSSKMSEKDLECTY
TIICSLVKNANSPEDVLETVKAISSKVVQQPNDKASLRLKILFNLYNLLDHPYARFQVYMKSLTLAVEGKVTEYVVPSFK
KIDNFLKEWNVDTKDQRELFLAIANVLRENKSLVKESLNFLTKYLATFSNDDAQVLGEAKEEAVRAVIEFVKASSIFQCD
LLDLPAVAQLEKDAKYAPVYQLLKIFLTQRLNAYSEFKAANSECLQSYGLVDEDCVTKMRLLSLVDLASHESGKIPYTSI
KDTLQVKEEEVELWIVKAITAKLIDCKMDQMNQVVIVSRCSEREFGSKQWQSLRTKLATWRDNIGNVISTIESNKVTEEG
SQTSSSAAPLQGLSVR*

DNA
ATGACGACGATTGTTCCCACCTCCGAAGAAGATCCATTTCTCTCCGTCGTCCAATTTACTTCCCAGCTAGCCTGGGCTGA
TGCTGGTCCCGAGGCTGCAGAGCCAGAGATTAGCAGGCTATGTAGAGAGGCTGAGGAATCGATAGTAGCAGGAAAGTGGT
TGGAGTTGGCTTCGTTAATGGTTACTTCAGCTGAATTGGTTTCTTCCAAGATGTCTGAGAAAGATCTTGAGTGTACCTAC
ACCATCATTTGCAGCCTTGTTAAGAATGCGAATAGCCCTGAAGATGTTCTCGAAACGGTGAAAGCTATCTCTTCTAAGGT
TGTTCAACAGCCGAATGACAAGGCTTCACTTCGTTTGAAGATCCTCTTCAATCTCTATAACCTCCTGGATCACCCGTATG
CTCGTTTCCAAGTGTACATGAAATCTCTCACACTGGCTGTTGAAGGGAAGGTTACTGAGTACGTTGTTCCTTCTTTTAAG
AAGATCGATAACTTCTTGAAAGAGTGGAACGTTGACACTAAAGATCAGAGGGAACTCTTCCTTGCCATTGCTAATGTTCT
GAGAGAGAACAAAAGCTTGGTAAAAGAATCCCTTAACTTCCTGACGAAGTATCTAGCGACTTTCTCCAATGATGATGCTC
AAGTCCTGGGTGAAGCTAAGGAGGAGGCTGTGCGTGCAGTTATTGAATTTGTCAAGGCTTCCAGCATCTTCCAGTGTGAT
TTATTGGACTTGCCGGCCGTAGCACAACTAGAGAAGGATGCTAAGTATGCACCTGTTTACCAGCTGCTAAAGATCTTTCT
TACTCAGAGGCTGAATGCTTACAGTGAATTCAAAGCTGCAAATTCAGAATGTCTGCAAAGCTATGGACTTGTCGATGAAG
ATTGTGTAACGAAGATGAGATTGTTGTCACTAGTGGACTTAGCGTCACATGAATCTGGCAAAATACCTTACACCTCAATT
AAAGACACTCTACAGGTAAAGGAAGAAGAGGTTGAACTATGGATCGTGAAGGCAATAACTGCGAAGCTGATCGATTGTAA
GATGGATCAGATGAACCAAGTTGTCATTGTCAGCCGCTGTTCCGAGCGTGAATTCGGGTCAAAGCAATGGCAATCACTTC
GAACTAAGCTCGCTACTTGGAGGGATAACATTGGAAACGTCATAAGTACAATTGAGTCGAACAAGGTAACCGAGGAAGGC
TCTCAGACATCATCATCTGCTGCACCACTTCAAGGCCTGAGTGTTCGTTGA