Details for Kale Locus Bo5g152750

Position : C5 ( 5`- 46481875 .. 46484199 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152750

Protein [Map View]
MNHLLEMKVKFLGETKIDKFKNSLVSRSRMSLWMIRVMTILLIWSCFVHLVALGGMWGPRLLKGWPCWLSHHEFPMAAQE
MASLPMKIALPPKRIYQNNGYLMVSCNGGLNQMRAAICDMVTIARYMNVTLIVPELDKASFWNDPSEFKDIFDVDHFITC
LRDEVRILKAVPPRLRRRVELGVYHTMPPVSWSNMSYYQDQILPLVKKHKVLQLNKTDTRLANNELPVEVQKLRCRVNFN
GLRFTPKIEELGRRVVKILREKGPFLVLHLRYEMDMLAFSGCSHGCNRYEEEELTRMRYAYPWWKEKVINSELKRKEGLC
PLTPEETALTLSALGIDRNVQIYIAAGEIYGGRRRLKALTDVFPNVVRKETLLDSSDLSFCQNRSSQMAALDYLIALESD
IFVPTYYGNMAKVVEGHRRFLGFKKTIELKRKFLVDLIDEYYEGLLSWEVFSTRLKASHGTRMGGPKKRLVIPSKPKEEN
YFYANPYECLQLLRESNGTSLKETM*

DNA
ATGAACCACCTCTTAGAGATGAAGGTTAAGTTTCTAGGAGAAACCAAGATTGACAAGTTCAAGAACTCCTTGGTTTCCAG
GTCTCGTATGAGCCTATGGATGATTCGGGTTATGACCATATTGCTGATATGGAGTTGTTTTGTTCATTTGGTTGCTTTGG
GTGGGATGTGGGGACCAAGGTTGCTGAAAGGCTGGCCTTGTTGGCTCAGCCACCATGAGTTCCCAATGGCTGCACAAGAA
ATGGCTTCTCTTCCAATGAAAATAGCCCTCCCTCCTAAAAGGATATATCAGAACAATGGTTATCTTATGGTTTCTTGCAA
TGGAGGACTCAACCAAATGCGAGCTGCGATATGTGATATGGTCACTATTGCAAGGTACATGAATGTCACACTTATTGTCC
CAGAGCTTGACAAGGCCTCTTTCTGGAATGATCCTAGTGAATTCAAAGACATATTTGATGTGGACCACTTCATAACTTGT
TTGAGAGATGAGGTTCGTATACTCAAAGCGGTTCCTCCAAGGCTTAGGAGAAGGGTCGAGCTCGGTGTGTACCACACCAT
GCCTCCTGTTAGCTGGTCTAACATGTCCTACTACCAAGACCAGATTCTTCCGTTGGTGAAGAAGCACAAGGTCTTACAAC
TGAACAAAACAGATACTCGACTTGCCAATAACGAACTTCCTGTCGAGGTTCAGAAGCTGAGATGCAGAGTAAATTTCAAC
GGGCTTAGGTTCACTCCAAAGATTGAGGAACTAGGTAGAAGAGTAGTCAAGATTCTGAGGGAGAAAGGTCCCTTTCTGGT
TCTCCATCTCAGATACGAAATGGACATGTTGGCATTCTCTGGTTGCTCTCACGGTTGCAACCGCTACGAAGAGGAAGAGC
TCACAAGAATGAGATATGCTTATCCATGGTGGAAAGAGAAAGTAATAAACTCCGAGTTGAAGAGGAAAGAAGGTCTTTGC
CCATTAACTCCGGAAGAAACAGCTCTTACACTATCCGCATTGGGCATTGACCGTAACGTTCAGATTTACATAGCGGCTGG
AGAGATATACGGTGGTAGAAGACGGTTAAAGGCTTTAACAGATGTTTTTCCAAATGTGGTCAGGAAAGAAACTCTGCTGG
ATTCGTCTGATCTGAGTTTCTGTCAGAACCGTTCTTCTCAAATGGCTGCTCTTGATTATCTCATCGCTCTAGAAAGTGAT
ATATTCGTTCCTACTTATTATGGGAACATGGCCAAAGTTGTGGAAGGTCATCGCAGGTTCTTGGGGTTCAAGAAAACGAT
TGAGCTAAAGAGGAAGTTCTTGGTTGATCTAATAGATGAATACTATGAAGGACTGTTGAGCTGGGAAGTGTTTTCGACCA
GGCTGAAGGCCTCTCACGGTACAAGAATGGGAGGTCCCAAGAAGCGGCTTGTGATTCCGAGTAAACCTAAAGAAGAAAAC
TACTTCTATGCTAATCCATATGAATGTCTTCAGCTATTACGTGAGAGTAATGGCACTTCACTTAAAGAAACAATGTGA