Details for Kale Locus Bo5g152740

Position : C5 ( 5`- 46462071 .. 46479156 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152740

Protein [Map View]
MADDLANLCRFLFDETGLTSSTSSSDLFSQRIRSDDSIKRGLRYFYLLLRSGIAPIGGDDDGSSVKLRFATWSDSQLQAL
VSISQAILLLSRSLLVDQVEPIVLGVIQEVMEFSLSFLEKSNFTQNDLKMEINMEMLLEIASFDGSEKQYDILPPVSPGE
AAELWSMFSPENDNLELHSLVKCTFQGGRCSTEEKPVDRLLISLMSECIESDVQTHSVSKPSFQQDYGNLNPLTRHLAVV
HLGCVCRLIMVCKELVQLPSVLDEKIIDHAFLDKLSFCLRILKLLGRLSKDVQSIENDGTLLQAVATFTDALPKLFRVFS
DFTTHTSTEGSIESLSLALVEGFLNLVQLIFGKSSLFQNVQACVSASIVNNLDASVWRYDVSSCNLMPPIAYFPRSVMYT
LRLVQDLNRQTYHIQDLRVLESEVGCENANSPADSVYFHLRQEKIPLLRGFTVEDIVRVIFPSSSQWVDNLFHLVYFLHL
EGVKLRPKVERAYSSLRSNSFAEVESQISHDDEALFGNLFSEDRRSLCSIEPNDHPPVAVSSNLPLQAVKELLNFLRVCI
FCKEWVPSIYEDGCKKLDTCHIDILLNILGSSFEDKASDGGGCMLQDEGKPGHVAFELLLNFLRGRALSDSLESYLFQKI
LAVENGEFEYNDKTLALLAHTLLCRPGLAGAQLRAKAYGGFVSFIADRARVICAEGSSVKELNSCLPSAFHIEILLMAFH
LSDESEKANFSNLIASCLHKVDTPSGICDGPQLSSWAMLISRLLVLLHHMLLHPNTCPTSLMLDLRSKLREVRSSGSNLH
VTVDHLSSWASLVARGITDSWAEEESVNHLMSQMIDFSPHPPTFQIDVSAAKTLNLDYRDLSASLSRILGLWKGKKAGKV
EDLIVERYIFILSWDIARVNCSLDSQPSLHINYQNVDICSTVDMIYTSHLLVGDSNIVGKNMKFRDILIGVLNQLHAAPE
KAVEDLGWDFIREGSWLSLLLYFINGGVWGYCKKNSCSEIDPFWRECTSIDAKYIATAEGVLSCLMETGDFTELLKMLSS
LASKYLQVYRKAFLATFSTWNHHGHSLPSLLLLKHTLFGKSLQAEYAKIGDNSLHLQCISYLSKLDALGDGRGSGVLWKV
FWEFMVHGFPTSLQTSSAILLSSILSIRCIVLTIDGLLKLRKSKENFGADSHVLQQIFNSIMAIKFDQVFQSFHDKCEDI
NQNICAMLEIPDFTELFLMKDMEGFVRDINAEKIDKSNVLEGVITQIVDVMDSLSKDSSKSDIFKFYLGVDSVSEHTMEF
YRLQRGDLSVFIDSLDYCSSELVNVKVLNFLVDLLSVAISPDIRRRIQQKFIDMDLTTLSGWLERTLLGSVVEENDGKKT
AKGNSLPLREAAMNFVNCLVSSANDLQTTELQNHLFEAILISLETAFISFDSHMAMSYFHFVLQLAKEDSLMKMVLKRTI
MLMEKLSADEKLLPGLKFLFGVIGSLLSNRSPSPGTSSCGKSLASNKNTATGPLIPKLAGTAKKSETLALPLDQEGSSIS
LECDVTSVDEDEDDGTSDGEVASLDKEDEEDANSERYLASKVCTFTSSGSNFMEQHWYFCYTCDLTVSKGCCSVCAKVCH
RGHRVVYSRSSRFFCDCGAGGVRGSSCQCLKPRKFSGIGSAPALGTNNLQSFLPLSEDVEQLAESDSDVDEDTFEEENNV
VLSIPKETQYKMSLLLEELGIEDRVLELFSSLLPSITSKRDSGLPRDKQVSLGKDKVLSFDTDLLQLKKAYKSGSLDLKI
KADYANSKDLKSLLASGSLAKSLLSVSMRGRLAVGEGDKVAIFDVGQLIGQATPATINADKANVKPLSRNIVRFEIVHLS
FNSVVENYLAVAGLEDCQILTLNHRGEVIDRLAVELALHGAYIRRIDWVPGSQVQLMVVTNKFVKIYDLSQDIISPTQYF
TLPDDMIVDATLFVAHRGRVFLLVLSEQGNLYRFELSLGGNAGATPLKEIVQILGKDVAGKGSSVYFSPTYRLLFISYHD
GSSFVGRLSSNATSVTETSAMFEEDSDGKQSVAGLHRWKELLGGSGLFICFSTVKSNAALAVSLRGDGVCAQNLRHPTGS
SSPMVGITAYKPLSKDNVHCLVLHDDGSLQIYSLVRNGVDPDSNFSAEKVKRLGSKILNNKTFAGEKPEFPLDFFEKAFC
ITADVRLGSDAIRNGDSEGAKQSLGSDDGFIESPSPMGFKISVSNPNPDIVMVGIRVHVGTTSASSIPSEVTIFQRSIKM
DEGMRCWYDIPFTVAESLLADEDIVISVGPTTSGTALPRIDSLEVYGRAKDEFGWKEKMDAVIDMEARVLGHGLLLPGSS
KKKALTRSASIEEQVIADGLKLLSIYYSVCRPRQEVELSELKCKQLLETIFESDREILLQTAACRVLQSIFPKKEIYYQV
KDTMRLLGVVKVTSILSSRLGISGTGGSIVEEFSAQMRAVSKIALTRKSNFSVFLEMNGSEVVDNLMQVLWGILDTEPLD
TPTMNNIVMSSVELIYSYAECLASQGKDTGVHSVAPAVQLLKALILSPNESVQTSSSLAISSRLLQVPFPKQTMLTTDEL
VDNVTTPPVPSRTAGGNTHVMIEEDSITSSVQYCCDGCSTVPILRRRWHCTVCPDFDLCEACHEVLDADRLPPPHTRDHP
MTAIPIDVESLGADTNEIQFSADEGITDLLPAITSSVPQASAPSIHVLEPGESAEFSAPVTDPVSISASMRAVNSLILSE
FLQELSGWMDTASGVQAIPIMQLFYRLSSAIGGAFMDSSKPEEISLEKLVKWLLAEINLSKPFDASTRSSFGEIVILVFM
FFTLMLRSWHQPGSDGSTSRAGGSTDVHDRRSVQSSTVVTSQSSLDVQVRDDFTSQLLRACSCLRSQEFVNYLMNILQQL
VHVFKSRTANVEARGSSSGCGAMLTVRRDLPAGNYSPFFSDSYAKAHRADLFVDYHRLLLENVFRLVYTLVRPEKQEKMG
EKEKVYRNASSKDLKLDGFQDALCSYINNPHTAFVRRYARRLFLHLCGSKTQYYSVRDSWQFSNEVKNLYKHVEKSGGFE
NNVSYERSVKIVKSLSTIAEVALARPRNWQKYCLRHGDFLSFLLNGVFHFAEESVIQTLKLLNLAFYQGKDVSGSVQKAE
ASDVLTGSNRSGPQSVDSKKKKKGEDAHDSGLDKSYVDMEGVVDIFSAKGGDLLKQFIDFFLLEWNSSSVRTEAKSVIYG
LWHHGRQSFKEILLAALLQKVRDLPVYGQNIVEYTELVCLLLGKAPESNSKQAINELVDRCLNPEVIRCIFETLHSQNEL
IANHPNSRIYNTLSNLVEFDGYYLESEPCVACSSPDVPYSKMKLESLKSETKFTDNRIIVKCTGSYTIQSVTMNVNDARK
SKSVKVLNLYYNNRPVSDLSELKNNWSLWKRAKSCHLSFNQTELKVEFPIPITACNFMIELDSFYENLQALSLEPLQCPR
CSRPVTDKHGICSNCHENAYQCRQCRNINYENLDSFLCNECGYSKYGRFEFNFMAKPSFIFDNMENDEDMKRGLAAIESE
SENAHRRYQQLLGFKKPLLKIVSSIGETEMDSQHKDTVQQMMASLPGPSCNKINRKVALLGVLYGEKCKAAFDSVSKSVQ
TLQGLRRVLMNYLHQKNSNFSSGASRCVVSKTPNNCYGCATTFVTQCLEILQMLSKHPRSRKQLVAAGILSELFENNIHQ
GPKTARAQARAALGTFSEGDLNAVSELNNLVQKKIMYCLEHHRSMDIALATREEMLLLSEVCSLTDEFWESRLRLVFQLL
FSSIKLGAKHPAISEHIILPCLKIISVACTPPKPDTTEKETMIGKTAPTVQEKDEKAPGISKSSSETEDNNSDVSQKTLD
IQLVSYLEWEKGASYLDFVRRQYKASQSIRGASQKSRTHRSDFLALKYALRWKRRTSRASKGGLQALELGSWVTELILSA
CSQSIRSEMCTLVSLLSAQSSPRRYRLINLLIGLLPATLAAGESSAEYFDLLFKMIETQDSLLFLTVRGCLTTICKLISQ
EVGNIESLERSLQIDISQGFTLHKLLELLGKFLEVPNIRSRFMRDNLLSHVLEALIVIRGLIVQKTKLINDCNGLLKDLL
DGLLLESSENKRQFIRACVSGLQTHAVEKKGRTCLFILEQLCNLICPSKPEAVYMLILNKSHTQEEFIRGSMTKSPYSSA
DIGPLMRDVKNKICQQLDLLGLLEDDYGMELLVAGNIISLDLSVAQVYELVWKKSNQSSTSLTNSALLASNAAPSRDCPP
MTVTYRLQGLDGEATEPMIKELEEDREESQDPEIEFAIASAVREYGGLEILLDMIKSLRDDFKSNEEEMVAVLDLLNHCC
KIRENRRALLRLGALSLLLETARRAFSVDAMEPAEGILLIVESLTLEANESDSVSAAQSSLTASNEETGTWEQAKKIVLM
FLERLSHPSGLKKSNKQQRNTEMVARILPYLTYGEPAAMEALIEHFNPYLQNWAEFDQLEQRHEENPKDESITQEAVKQR
FTVENFVRVSESLKTSSCGERLKDIVLEKGIIAAAVKHIKEIFSVTKQAGYKSSPEWLAALKLPSVPLILSMLRGLSMGH
LPTQTCIDEGGILPLLHALEGVAGENEIGARAENLLDTLADKEGKGDGFLGEKVCALRDATKNEMRRRALKKRQELLKGL
GMHQEVSSDGGERIVVSQPILEGFEDVEEEGDGLACMVCREGYKLRPTDLLGVYSYSKRVNLGVGTSGSARGECVYTTVS
YFNIIHFQCHQEAKRADAALKNPKKEWEGAMLRNNESLCNSLFPVKGPLVPLAQYLRYVDQYWDNLNALGRADGSRLRLL
TYDIVLMLARFATGASFSADCRGGGRDSNSRFLPFMFQMARHLLDQGGPSQRTNMAKSVSSYISSSTSTATAPSSDSRPI
TPGSQLSSTGTEETVQFMMVNSLLSESYESWLQHRRVFLQRGIYHTFMQHAHGRAASRAAESSSAGGKSQDAETLTGDEL
LSIVKPMLVYTGMIEQLQQFFKPKKPAQVEPNKKEGTSSGVELEPWEIVMKEKLLNVKDMVGFSKELISWLDDINSATDL
QEAFDIVGVLADVLSGGVSQCDEFVRSAIVAGNGKG*

DNA
ATGGCAGATGACTTGGCGAATCTCTGCCGATTTCTCTTCGACGAGACCGGCCTCACCTCGTCGACGTCATCCTCAGATCT
CTTTTCGCAACGCATACGCTCCGATGATTCGATCAAGCGCGGCCTCCGTTACTTCTATCTACTCCTCCGCTCGGGAATCG
CTCCGATCGGCGGAGATGATGATGGCTCATCCGTCAAGCTACGGTTTGCGACCTGGTCAGATTCGCAGCTTCAAGCTCTT
GTTTCGATATCTCAGGCGATCCTTCTACTATCGCGATCTCTATTAGTGGACCAAGTGGAACCTATAGTTCTGGGTGTTAT
CCAGGAGGTGATGGAGTTCTCTCTCAGCTTCTTGGAGAAGTCCAACTTCACACAAAATGATCTGAAAATGGAGATTAACA
TGGAAATGCTTTTGGAGATTGCTTCTTTTGATGGAAGTGAGAAGCAATATGATATATTGCCACCTGTCTCTCCTGGTGAA
GCTGCAGAACTGTGGTCAATGTTTTCTCCCGAGAATGATAATTTGGAATTACATAGCCTTGTGAAATGTACTTTTCAAGG
GGGCAGGTGCTCAACTGAAGAGAAGCCAGTTGACCGGCTTCTTATTTCGCTGATGTCTGAATGCATTGAATCTGATGTCC
AGACTCATTCAGTAAGCAAACCCTCTTTTCAGCAAGACTACGGCAACCTGAATCCCCTGACTCGACACCTGGCTGTTGTT
CACCTTGGCTGTGTTTGTCGTCTTATTATGGTCTGCAAAGAGCTTGTTCAACTGCCAAGTGTGTTAGATGAGAAGATCAT
TGATCATGCTTTCCTTGATAAGTTGTCCTTCTGCTTAAGAATTCTGAAGCTGCTTGGAAGACTTTCCAAAGATGTTCAAA
GTATAGAAAACGACGGGACCTTGTTACAAGCTGTAGCTACATTCACAGATGCTTTGCCTAAGCTGTTTAGGGTTTTCTCC
GACTTCACTACTCACACTTCTACAGAGGGTAGTATTGAGAGTCTTTCTCTAGCGCTGGTGGAAGGGTTTCTTAATCTTGT
CCAACTCATCTTTGGCAAGAGTAGTCTATTTCAAAATGTCCAGGCATGTGTATCAGCTTCTATTGTGAACAATCTAGATG
CCTCAGTGTGGAGATATGATGTGTCCTCTTGTAATTTGATGCCTCCGATTGCTTACTTCCCTCGGTCTGTCATGTACACA
TTGAGACTCGTTCAAGATCTGAATAGACAAACATACCATATCCAAGATCTGAGGGTTTTAGAGTCAGAAGTCGGCTGTGA
AAATGCCAATTCCCCTGCTGATTCTGTTTATTTCCATCTGCGCCAGGAAAAGATCCCGTTGCTCAGAGGCTTCACGGTCG
AGGATATAGTGAGAGTGATATTTCCTTCCTCAAGTCAGTGGGTGGACAACTTGTTTCATCTTGTTTACTTCCTTCACCTT
GAAGGAGTAAAATTACGACCAAAAGTGGAGAGAGCATATTCTAGTTTGAGATCCAACAGTTTTGCTGAAGTTGAAAGCCA
AATTTCTCATGATGATGAAGCCCTGTTTGGAAACTTGTTCTCTGAGGATCGCCGCTCTCTGTGTTCCATAGAACCAAACG
ATCATCCACCCGTTGCTGTCAGCAGCAATTTACCACTGCAAGCTGTAAAGGAACTGTTGAACTTTCTTAGAGTGTGCATT
TTCTGTAAAGAATGGGTTCCTAGCATATACGAAGATGGATGCAAAAAGCTTGATACATGTCACATTGATATCCTGCTCAA
TATACTAGGCAGCAGTTTTGAAGACAAGGCCTCTGATGGTGGTGGTTGCATGCTTCAAGATGAAGGAAAACCTGGACATG
TTGCCTTTGAGCTGTTACTCAATTTCTTAAGAGGTCGTGCTCTGTCTGATTCTCTTGAGTCCTACCTTTTTCAGAAAATC
CTTGCTGTTGAAAATGGTGAGTTCGAGTATAACGATAAGACTCTGGCACTTTTGGCTCACACTCTCCTTTGTAGGCCGGG
ATTGGCTGGGGCACAGTTGAGAGCCAAAGCTTATGGTGGTTTCGTTAGTTTTATTGCCGACAGAGCAAGAGTAATATGTG
CTGAAGGTTCGAGTGTCAAGGAGTTGAACTCGTGTCTTCCCTCTGCTTTCCATATTGAGATTCTTCTTATGGCTTTCCAT
TTATCAGATGAATCAGAGAAGGCCAATTTCTCAAATCTTATTGCCTCGTGTCTGCATAAAGTTGATACTCCGTCAGGAAT
ATGTGATGGTCCTCAGTTGTCCTCTTGGGCGATGCTGATATCTAGGTTGTTAGTGCTGTTGCACCATATGTTGTTGCATC
CAAACACTTGTCCAACATCATTAATGCTAGATCTGAGGTCTAAACTGAGGGAAGTTCGTAGCTCTGGCAGTAATTTACAT
GTAACCGTTGATCATCTGTCTTCTTGGGCGTCTCTTGTTGCAAGGGGAATAACTGATTCATGGGCTGAAGAGGAGTCAGT
CAACCATCTGATGAGTCAAATGATCGACTTTTCCCCACATCCTCCTACATTTCAGATTGATGTGTCTGCTGCCAAAACCC
TAAACCTGGATTACAGAGATCTGTCTGCAAGTTTGTCCCGGATATTGGGGTTGTGGAAGGGGAAAAAGGCTGGAAAAGTG
GAAGACCTGATAGTGGAAAGATACATTTTCATACTTTCTTGGGATATTGCTCGTGTTAACTGTTCATTGGATAGTCAGCC
TTCGTTGCATATCAATTACCAGAATGTGGACATATGTAGCACTGTGGATATGATCTACACCAGTCATTTGCTTGTAGGCG
ACTCCAACATCGTTGGTAAGAATATGAAGTTCAGAGACATTCTGATTGGTGTTTTAAATCAGCTCCATGCTGCACCTGAG
AAGGCGGTTGAGGATTTGGGTTGGGATTTTATTCGTGAAGGATCTTGGCTCTCTCTTCTGTTATATTTCATCAATGGTGG
CGTCTGGGGTTATTGCAAGAAAAATTCATGTTCAGAAATCGATCCCTTCTGGAGGGAGTGCACATCTATCGACGCTAAAT
ATATTGCTACTGCCGAAGGCGTACTCTCCTGCTTGATGGAAACTGGTGACTTTACAGAATTGCTGAAAATGCTTTCATCG
TTGGCTAGCAAATATCTACAAGTGTATAGGAAAGCTTTCCTTGCAACTTTCAGTACTTGGAATCACCATGGCCACAGTTT
GCCGTCTCTGCTACTTCTCAAGCATACTCTATTTGGTAAAAGTCTCCAAGCTGAATACGCGAAGATTGGTGACAATTCCC
TTCATCTTCAGTGCATTTCTTATCTGTCGAAACTGGATGCTCTGGGTGATGGAAGAGGTTCGGGTGTTTTATGGAAAGTC
TTTTGGGAATTTATGGTACATGGTTTTCCCACTAGTCTTCAAACTTCCAGTGCGATTCTTCTGTCAAGTATTCTAAGCAT
AAGGTGTATTGTGCTGACAATAGATGGTTTGCTCAAGCTGCGCAAGTCAAAGGAAAATTTTGGGGCAGATTCTCATGTAC
TTCAACAGATATTTAACTCGATCATGGCTATTAAGTTTGATCAGGTATTCCAAAGCTTTCATGACAAATGTGAGGATATC
AATCAAAATATATGTGCCATGTTGGAGATTCCAGATTTTACGGAGTTGTTCCTGATGAAAGACATGGAGGGGTTTGTAAG
AGATATCAATGCTGAGAAGATAGATAAAAGCAATGTGCTTGAAGGGGTGATCACCCAGATTGTAGATGTTATGGACAGCC
TAAGCAAGGATTCTTCGAAATCTGATATATTCAAATTTTATCTTGGTGTGGATTCAGTCTCTGAGCATACCATGGAATTC
TATCGGTTGCAACGCGGAGATCTGTCTGTTTTTATCGACTCACTGGACTACTGTTCTTCGGAACTGGTAAACGTAAAAGT
ACTCAACTTCCTTGTTGATCTTTTGTCTGTAGCTATATCCCCCGATATCAGGAGAAGAATACAGCAAAAATTTATTGACA
TGGATTTAACAACTCTGTCTGGGTGGCTGGAGCGAACACTGTTGGGTTCCGTCGTTGAGGAAAATGATGGTAAAAAGACT
GCAAAAGGAAATTCTCTTCCTCTCAGAGAGGCAGCAATGAATTTTGTGAATTGTCTTGTGTCATCTGCTAACGACCTACA
GACCACAGAGTTACAGAATCATTTATTCGAGGCCATCCTGATCTCCCTTGAGACAGCATTTATCTCATTTGATAGCCACA
TGGCTATGTCATATTTTCATTTTGTTCTTCAACTAGCAAAGGAAGACAGCCTGATGAAAATGGTCTTAAAGAGAACCATA
ATGCTAATGGAGAAGCTTTCTGCCGATGAGAAGTTGCTTCCTGGTTTAAAGTTTCTTTTTGGCGTGATAGGCAGCTTGTT
GAGTAACCGTTCTCCAAGCCCCGGAACGAGTTCCTGTGGAAAGTCCTTGGCGAGCAATAAAAATACTGCAACTGGTCCTT
TGATCCCAAAACTTGCAGGAACAGCAAAAAAATCTGAAACATTGGCTCTCCCCCTGGATCAGGAAGGAAGCTCAATTTCA
CTTGAATGTGATGTCACTTCTGTTGATGAAGATGAAGATGATGGAACATCTGATGGTGAAGTGGCCAGCTTAGACAAGGA
AGATGAAGAAGATGCCAACAGTGAGAGGTACCTTGCCTCAAAAGTCTGCACTTTCACTTCCAGTGGCAGTAATTTCATGG
AGCAACACTGGTATTTTTGTTACACCTGCGACCTTACTGTGTCCAAAGGTTGCTGTTCTGTTTGCGCAAAAGTTTGCCAC
CGGGGTCACCGTGTTGTCTATTCACGATCAAGTCGGTTTTTCTGTGACTGTGGAGCCGGAGGTGTAAGGGGAAGCAGCTG
CCAGTGCTTGAAGCCGCGGAAATTCAGTGGCATTGGTAGCGCTCCAGCTCTTGGTACAAATAATTTGCAGTCCTTTTTAC
CCTTGTCTGAGGATGTAGAACAGCTTGCAGAAAGCGATTCCGATGTGGACGAAGATACTTTCGAGGAGGAAAATAACGTC
GTGTTATCTATCCCTAAGGAAACTCAATATAAGATGTCACTGCTACTAGAAGAGCTCGGCATAGAGGACAGAGTGCTGGA
GCTTTTCTCTTCTTTGCTTCCGTCTATCACTAGCAAAAGAGACTCTGGTCTTCCGAGAGATAAGCAAGTCAGTCTCGGGA
AAGACAAGGTTCTTTCATTTGATACAGATCTTTTGCAGTTGAAAAAAGCATATAAAAGTGGATCACTTGACTTGAAAATA
AAGGCTGACTATGCTAACTCGAAGGACCTTAAATCTCTTTTAGCCAGTGGCTCCCTTGCCAAGTCTCTTCTGAGTGTTAG
TATGCGGGGTCGCCTCGCAGTTGGAGAAGGTGATAAAGTTGCTATATTTGATGTTGGGCAGCTAATAGGACAAGCCACAC
CTGCAACGATAAATGCAGACAAGGCCAATGTTAAACCACTTTCCAGGAATATTGTTCGTTTTGAGATTGTGCATCTTTCT
TTCAACTCAGTTGTGGAGAATTATCTTGCTGTCGCAGGCCTTGAAGACTGCCAGATACTTACTTTGAATCATCGAGGTGA
AGTCATCGACAGGCTTGCTGTTGAGCTTGCCTTGCATGGTGCATACATCAGGCGTATAGACTGGGTTCCTGGTTCACAGG
TTCAGTTAATGGTCGTTACAAACAAATTCGTGAAGATTTATGATTTATCCCAGGATATCATCAGTCCAACACAGTACTTC
ACCTTGCCAGATGACATGATTGTGGATGCTACCCTCTTTGTTGCTCATCGTGGGAGGGTTTTTCTTCTTGTTCTTTCAGA
GCAGGGAAATTTGTACAGGTTTGAACTATCTCTGGGAGGAAATGCAGGCGCAACACCACTTAAGGAAATCGTTCAGATTT
TAGGAAAGGATGTTGCCGGAAAGGGTTCATCTGTCTATTTCTCTCCGACATATCGACTGCTTTTTATATCCTATCATGAT
GGAAGTTCCTTTGTGGGTCGGCTCAGCTCAAACGCAACATCCGTAACTGAAACATCTGCAATGTTTGAGGAGGACTCAGA
TGGTAAACAGAGTGTGGCTGGACTGCATCGTTGGAAGGAGTTGTTGGGTGGTAGTGGATTATTTATTTGCTTCTCCACCG
TGAAATCAAATGCTGCCTTGGCTGTGTCCCTAAGGGGTGATGGGGTATGTGCACAGAATCTACGTCATCCGACAGGATCT
TCGTCCCCTATGGTCGGAATAACTGCATACAAACCTTTGTCAAAAGACAATGTTCACTGTCTTGTTCTGCATGATGATGG
CAGCCTTCAGATTTATTCCCTTGTTCGGAATGGAGTTGATCCTGACTCCAATTTCTCAGCTGAAAAGGTTAAAAGGTTGG
GTTCTAAGATTCTTAACAACAAAACCTTCGCTGGTGAAAAGCCGGAGTTTCCCCTGGATTTCTTTGAGAAGGCATTTTGC
ATTACAGCAGATGTGAGACTCGGTAGTGATGCTATCAGAAATGGTGATTCCGAGGGAGCGAAACAAAGCTTGGGATCTGA
CGATGGTTTTATTGAGAGCCCCAGTCCCATGGGCTTTAAGATATCAGTCTCCAATCCAAACCCTGACATTGTTATGGTTG
GCATCCGGGTGCATGTGGGTACTACATCAGCAAGCTCTATACCTTCAGAAGTGACCATTTTTCAGAGATCGATTAAGATG
GATGAGGGCATGAGGTGCTGGTATGACATTCCATTTACAGTGGCTGAGTCACTTCTAGCTGATGAAGATATTGTAATCTC
AGTGGGGCCGACTACTAGTGGGACTGCATTGCCCAGAATAGACTCACTTGAAGTATATGGTCGTGCTAAAGATGAATTTG
GCTGGAAAGAGAAAATGGATGCTGTGATAGATATGGAAGCTCGTGTGCTTGGTCATGGTCTGCTTCTTCCAGGCTCTAGT
AAAAAGAAAGCGTTGACACGGTCTGCTTCTATTGAGGAGCAAGTTATCGCAGATGGTCTCAAACTCCTATCAATCTATTA
TTCAGTTTGTAGGCCACGGCAAGAAGTGGAGCTTAGTGAACTTAAATGCAAACAGCTACTGGAGACAATTTTCGAAAGTG
ATAGGGAAATTCTGTTACAAACTGCAGCTTGCCGTGTTTTGCAGTCTATCTTTCCAAAAAAGGAGATATACTATCAGGTC
AAAGACACCATGCGACTTCTTGGAGTGGTCAAGGTCACCTCTATTCTTTCTTCAAGGTTGGGCATTTCTGGTACTGGAGG
GTCGATTGTTGAAGAGTTCAGTGCTCAGATGCGGGCGGTGTCTAAAATAGCTTTGACCCGTAAATCCAATTTCTCCGTCT
TTCTGGAGATGAATGGTTCTGAAGTAGTGGATAATCTGATGCAAGTGCTATGGGGAATTTTAGATACGGAGCCACTTGAT
ACACCAACTATGAACAATATCGTGATGTCCTCCGTTGAACTAATCTATAGCTATGCTGAGTGTTTGGCATCTCAAGGAAA
GGATACCGGGGTTCATTCTGTAGCTCCTGCTGTTCAGTTACTGAAAGCACTTATATTATCTCCTAATGAGTCTGTGCAAA
CATCCAGCAGCTTAGCCATATCATCAAGGTTACTTCAGGTTCCTTTCCCAAAGCAAACGATGTTGACAACAGATGAATTG
GTAGACAATGTTACAACTCCTCCGGTACCTAGCAGAACAGCCGGTGGAAATACACATGTCATGATTGAAGAGGACTCTAT
AACTTCATCTGTTCAATACTGCTGTGATGGCTGCTCCACTGTCCCTATACTGAGAAGGAGGTGGCATTGCACCGTGTGTC
CAGATTTTGATTTATGTGAGGCATGCCATGAAGTGTTAGATGCAGATCGTCTGCCACCACCACATACTCGAGATCATCCC
ATGACAGCAATTCCAATTGATGTGGAATCACTTGGTGCTGATACCAATGAAATTCAGTTCTCCGCAGATGAAGGTATTAC
TGATTTGTTGCCAGCGATAACCAGTAGTGTCCCACAAGCGTCAGCTCCTTCAATCCATGTCTTGGAACCTGGTGAATCTG
CTGAGTTTTCGGCCCCAGTGACCGATCCCGTTTCTATCTCAGCTTCTATGCGGGCTGTTAATTCGTTAATTCTCTCCGAG
TTTCTTCAAGAGTTGAGTGGATGGATGGATACAGCATCCGGTGTTCAAGCTATACCTATCATGCAATTGTTCTACAGATT
ATCATCTGCCATTGGTGGAGCCTTCATGGATAGCTCAAAGCCCGAAGAAATAAGCTTGGAAAAGTTAGTTAAATGGCTTT
TGGCTGAAATCAACCTAAGCAAGCCGTTTGATGCGTCAACTCGCTCTTCCTTTGGGGAAATTGTGATTCTTGTGTTTATG
TTTTTCACCTTGATGCTTCGGAGTTGGCACCAACCTGGCAGTGATGGTAGTACGTCCAGGGCAGGTGGAAGCACAGATGT
ACATGATCGGAGGAGTGTCCAGAGCTCCACTGTGGTTACTTCTCAGTCTTCATTAGATGTTCAAGTGAGAGATGACTTTA
CGTCTCAGCTACTTCGAGCTTGTAGTTGCCTCAGGAGCCAAGAGTTTGTTAATTATCTAATGAACATTCTTCAGCAGCTA
GTGCATGTTTTTAAGTCCCGTACTGCCAATGTTGAAGCACGTGGATCAAGCTCTGGTTGTGGGGCCATGCTTACAGTAAG
AAGAGATTTACCTGCGGGTAACTATTCCCCCTTCTTTTCGGATTCATATGCAAAAGCCCATCGAGCAGATTTATTTGTGG
ACTATCACAGGCTGCTACTTGAGAATGTGTTTCGCTTAGTTTATACCTTGGTTAGACCTGAAAAGCAAGAGAAAATGGGG
GAAAAGGAAAAGGTTTACAGGAATGCTTCTTCTAAAGATTTAAAGTTGGACGGTTTCCAGGATGCTCTGTGCAGCTATAT
CAATAACCCTCATACGGCTTTTGTTAGGAGATATGCTAGAAGGCTGTTTTTGCATCTTTGTGGAAGCAAAACTCAGTACT
ACAGTGTCCGAGATTCATGGCAGTTTTCCAATGAAGTGAAGAACCTATACAAGCATGTTGAAAAGTCTGGAGGTTTTGAA
AACAATGTTTCGTATGAAAGGAGTGTAAAGATTGTGAAGTCGCTTTCTACAATTGCTGAAGTTGCTTTAGCGCGCCCTCG
GAACTGGCAAAAATACTGTCTCAGGCATGGAGATTTTCTGTCTTTCTTACTGAATGGCGTATTCCATTTTGCGGAAGAGT
CTGTTATCCAGACACTTAAACTCCTCAATTTAGCCTTTTATCAAGGAAAAGATGTGAGCGGCTCAGTGCAGAAAGCTGAA
GCAAGTGATGTATTGACAGGCTCAAACCGATCTGGACCCCAGTCCGTGGATTCAAAAAAGAAGAAAAAAGGTGAAGATGC
GCATGATTCTGGTTTGGACAAATCATACGTGGATATGGAAGGGGTGGTAGATATCTTCAGTGCCAAGGGCGGAGATCTCT
TGAAGCAGTTTATTGATTTCTTTCTGCTGGAATGGAATTCAAGTTCTGTTCGCACTGAAGCAAAATCTGTTATCTATGGC
TTGTGGCATCATGGAAGACAATCGTTCAAAGAAATTCTGTTAGCAGCTCTTTTGCAGAAGGTTAGAGACTTGCCAGTGTA
TGGTCAGAATATTGTTGAGTACACAGAACTTGTCTGCTTGTTGCTCGGCAAGGCTCCAGAAAGCAACTCAAAGCAAGCAA
TAAACGAGCTTGTGGATCGTTGCCTTAACCCTGAAGTGATAAGGTGCATTTTTGAGACGCTGCATTCTCAGAACGAACTC
ATTGCCAATCATCCAAACTCCCGTATATACAACACTCTGAGCAATCTTGTGGAATTTGACGGTTATTATCTTGAGAGCGA
ACCCTGCGTTGCCTGCAGTTCGCCCGATGTGCCATATAGCAAAATGAAGCTTGAAAGTTTGAAATCTGAGACAAAGTTTA
CCGATAACCGCATCATTGTGAAATGTACTGGGAGTTATACGATACAGTCTGTGACCATGAATGTTAATGATGCACGGAAG
TCAAAGTCGGTGAAGGTCCTAAACCTGTATTACAACAATCGCCCGGTCTCGGATTTGTCAGAGCTTAAAAACAACTGGTC
ACTGTGGAAGCGTGCCAAGAGTTGCCATTTGTCCTTTAACCAAACTGAACTGAAGGTGGAGTTTCCCATTCCTATTACGG
CTTGTAACTTCATGATCGAGTTGGATTCCTTCTATGAGAATCTTCAGGCGTTATCTCTTGAACCATTGCAATGCCCTCGA
TGCAGTCGACCGGTTACTGATAAGCATGGTATCTGCAGCAACTGTCATGAGAATGCTTATCAGTGCAGGCAATGCCGCAA
CATCAACTACGAAAATTTGGATTCTTTCCTGTGCAACGAGTGTGGTTATAGCAAGTATGGGAGGTTTGAGTTCAACTTCA
TGGCAAAACCGAGCTTCATATTTGATAATATGGAAAATGACGAAGATATGAAGAGGGGATTGGCTGCTATAGAGTCTGAG
TCTGAAAACGCTCACAGGAGATATCAGCAACTCTTAGGCTTCAAGAAGCCGCTTCTGAAGATAGTATCAAGCATTGGTGA
AACTGAAATGGATTCACAGCACAAGGACACTGTCCAGCAAATGATGGCATCTTTGCCTGGTCCCTCATGCAACAAGATAA
ACCGCAAAGTCGCACTTTTGGGTGTACTGTATGGTGAGAAGTGCAAAGCTGCTTTTGATTCTGTCAGCAAAAGTGTACAA
ACACTGCAGGGACTTCGCAGAGTTCTGATGAATTACCTCCATCAGAAAAATTCGAACTTTTCATCTGGTGCTTCAAGATG
TGTGGTTTCAAAGACCCCAAACAATTGTTACGGTTGTGCCACTACATTTGTCACTCAATGTCTCGAGATTCTTCAAATGC
TGTCGAAGCATCCAAGATCTAGGAAACAACTTGTTGCAGCTGGTATCTTGTCCGAGTTGTTTGAAAACAATATTCACCAA
GGTCCGAAAACAGCCCGTGCTCAAGCTAGGGCAGCTCTAGGAACTTTCTCGGAAGGTGATCTGAATGCAGTGAGTGAGTT
AAATAATCTGGTACAGAAGAAAATAATGTACTGCCTTGAACACCATCGTTCCATGGACATTGCGCTCGCCACTCGTGAGG
AGATGTTGTTGCTTTCAGAAGTATGCTCTCTCACTGATGAATTCTGGGAGTCAAGACTGCGCCTTGTTTTTCAGCTATTA
TTTTCTTCCATTAAATTGGGTGCTAAACATCCTGCTATATCAGAGCACATAATTCTTCCTTGCCTAAAGATCATTTCTGT
GGCGTGTACACCTCCAAAACCAGATACGACAGAGAAAGAAACAATGATAGGAAAAACTGCTCCCACAGTGCAAGAAAAGG
ATGAGAAAGCTCCCGGCATCTCAAAGTCTTCGTCAGAAACCGAAGATAATAACTCGGATGTATCTCAGAAGACGCTAGAT
ATTCAGCTTGTGAGTTATTTGGAATGGGAGAAGGGGGCATCATATCTCGACTTTGTGAGGAGGCAATACAAAGCCTCTCA
GTCAATTAGAGGTGCTAGCCAAAAGTCTAGAACCCACAGATCAGATTTCTTGGCACTTAAATATGCACTTAGGTGGAAGC
GACGCACTAGCAGGGCATCTAAAGGTGGTTTACAGGCGCTTGAGCTCGGGTCTTGGGTCACAGAGCTAATTCTTAGTGCA
TGTTCTCAATCTATTAGATCAGAGATGTGCACGCTGGTTAGTTTACTCTCTGCCCAAAGCTCACCTAGGCGCTACAGGCT
GATCAATTTGCTGATAGGGTTGCTTCCCGCTACGCTTGCAGCTGGTGAAAGCAGCGCCGAATACTTTGATCTGCTCTTTA
AAATGATCGAGACCCAAGATTCACTTCTATTTTTAACCGTTCGGGGTTGTCTGACAACTATCTGTAAATTGATCTCCCAA
GAGGTAGGAAACATTGAATCTCTAGAAAGAAGCCTTCAGATAGACATTTCACAGGGATTTACCCTCCATAAGCTCTTAGA
ACTCCTTGGAAAGTTCTTAGAGGTTCCAAATATTCGATCCAGATTCATGAGAGACAATTTGCTGTCACATGTTCTGGAGG
CCCTCATTGTCATCCGTGGCTTGATAGTGCAAAAGACGAAGCTTATAAATGACTGTAACGGACTCCTGAAAGATCTTCTC
GACGGTCTTCTGCTTGAAAGCAGTGAAAATAAACGACAATTCATCCGTGCATGTGTTTCTGGACTACAAACCCATGCGGT
AGAGAAGAAAGGACGTACCTGTTTGTTTATTCTTGAGCAGCTTTGTAATTTGATCTGCCCATCGAAACCCGAGGCTGTGT
ATATGCTGATCTTGAACAAGTCACACACGCAAGAGGAGTTTATCCGGGGTTCAATGACGAAAAGTCCATATTCAAGTGCT
GATATTGGCCCACTGATGCGGGATGTTAAAAACAAGATTTGTCAGCAGTTGGACCTGTTAGGTCTATTGGAAGATGACTA
TGGCATGGAGTTGCTTGTAGCAGGAAACATTATTTCACTAGACCTGAGTGTAGCACAAGTTTATGAGCTGGTTTGGAAGA
AATCAAATCAGTCTTCTACTTCCCTGACAAACTCGGCACTTTTAGCTTCAAATGCAGCTCCCAGCAGGGATTGTCCTCCC
ATGACTGTGACATACAGACTTCAGGGGCTAGATGGTGAAGCTACTGAACCTATGATCAAGGAATTGGAAGAAGATAGAGA
AGAATCACAAGATCCAGAGATTGAGTTTGCAATAGCAAGTGCAGTTCGGGAATATGGTGGTCTGGAAATTTTACTTGATA
TGATCAAGAGTTTACGAGATGACTTCAAATCCAACGAAGAAGAGATGGTTGCAGTTCTTGATCTCCTAAACCACTGCTGC
AAGATTAGAGAGAACAGGCGAGCTTTGCTCAGGCTAGGAGCTTTAAGCTTACTTCTTGAAACAGCTAGGAGGGCATTTTC
TGTGGATGCTATGGAGCCAGCTGAAGGCATTCTCTTAATTGTCGAGAGTTTGACTCTTGAAGCAAACGAAAGTGACAGCG
TCAGCGCTGCACAAAGTTCTTTGACTGCCAGTAACGAGGAAACTGGAACTTGGGAACAGGCCAAGAAAATAGTGCTTATG
TTCTTAGAAAGGCTAAGCCATCCTTCGGGGCTTAAGAAGTCAAACAAACAGCAAAGAAACACGGAGATGGTTGCTAGAAT
CTTGCCTTACTTAACATACGGTGAGCCAGCAGCGATGGAAGCACTCATAGAGCACTTCAACCCTTATCTGCAAAACTGGG
CCGAATTTGATCAACTTGAGCAACGTCATGAAGAGAATCCCAAAGACGAGAGCATTACTCAGGAAGCGGTGAAGCAGAGA
TTTACTGTTGAGAATTTTGTTAGAGTGTCAGAATCTCTGAAGACAAGTTCATGTGGAGAGAGGTTAAAGGACATTGTTTT
GGAGAAAGGCATCATAGCTGCTGCTGTCAAACACATCAAAGAAATATTCTCTGTCACAAAACAGGCTGGATACAAATCTA
GCCCAGAATGGCTTGCGGCTCTTAAACTCCCTTCGGTGCCTCTTATTTTGTCAATGCTAAGAGGATTGTCGATGGGGCAT
TTGCCAACCCAGACCTGCATAGACGAGGGAGGAATTCTACCCTTACTTCATGCCTTAGAAGGAGTCGCTGGAGAAAACGA
GATTGGTGCAAGAGCTGAGAATTTGCTAGACACTCTCGCTGATAAAGAAGGAAAAGGAGATGGATTTCTTGGAGAGAAAG
TTTGTGCATTACGAGATGCTACCAAAAATGAGATGAGACGCCGTGCACTAAAAAAGAGACAGGAGCTCCTAAAGGGCCTT
GGAATGCATCAAGAGGTATCTTCTGATGGTGGTGAAAGGATTGTGGTTTCTCAACCAATTCTCGAAGGTTTTGAGGATGT
GGAGGAAGAAGGTGATGGATTAGCTTGCATGGTGTGCAGAGAAGGCTACAAACTCAGACCTACTGATTTATTAGGAGTGT
ACTCTTACAGCAAACGGGTGAATCTTGGTGTTGGCACTTCCGGAAGTGCACGTGGCGAATGCGTTTATACTACCGTGAGC
TACTTCAACATCATTCATTTCCAGTGTCATCAAGAGGCAAAAAGAGCCGATGCTGCTCTTAAAAACCCGAAGAAAGAATG
GGAAGGAGCTATGCTACGTAACAATGAATCTCTTTGCAACTCTCTCTTCCCTGTCAAAGGTCCCTTGGTTCCTTTAGCTC
AGTACCTACGCTACGTTGACCAGTACTGGGATAATCTCAATGCTCTTGGTCGAGCCGACGGAAGCAGACTCCGCCTATTG
ACATATGACATAGTCCTGATGTTGGCTCGGTTTGCAACGGGAGCTTCTTTTAGCGCGGATTGCAGAGGTGGAGGAAGAGA
TAGCAATTCACGTTTCTTGCCTTTCATGTTTCAAATGGCCCGTCATCTTCTCGACCAAGGAGGTCCCTCGCAACGCACCA
ACATGGCTAAATCCGTTTCATCATACATATCATCATCGACATCTACAGCAACAGCGCCGTCATCGGACTCACGGCCTATA
ACTCCTGGATCTCAGCTATCATCAACTGGAACGGAGGAAACCGTTCAGTTCATGATGGTAAACTCGCTTCTGTCGGAATC
GTATGAATCATGGCTCCAACACCGTCGTGTCTTTCTCCAGCGCGGGATTTACCATACCTTCATGCAACACGCTCACGGTC
GGGCAGCCTCTCGTGCTGCGGAATCATCCAGTGCAGGAGGCAAAAGCCAAGACGCGGAAACCTTAACCGGCGATGAACTT
CTCTCTATCGTCAAGCCAATGCTGGTCTACACCGGTATGATAGAACAGCTTCAACAGTTCTTTAAACCAAAGAAACCAGC
TCAGGTCGAACCAAACAAGAAAGAAGGTACGTCAAGTGGGGTAGAGCTGGAACCGTGGGAGATTGTAATGAAAGAGAAGT
TGTTGAATGTGAAAGATATGGTTGGTTTCTCAAAAGAATTGATCTCTTGGCTCGACGACATCAACTCTGCAACTGATCTA
CAAGAAGCTTTTGATATCGTCGGCGTTCTAGCTGATGTTTTGTCCGGAGGAGTTTCTCAGTGCGATGAGTTTGTGAGATC
AGCGATAGTTGCTGGAAATGGGAAAGGCTGA