Details for Kale Locus Bo5g152730

Position : C5 ( 5`- 46456804 .. 46457798 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152730

Protein [Map View]
MGCVTSCFRVQDIDEYMNPNSSVYRNCPCIRCLARNFLNLYSSVFGRGEIRALPSSVQATTPSITSSSSHDNFLSEAFRS
TPRPLPYDADPRHFRSLVSRREKGSSHSHEEAEPLRSDSDADSESFGCKWANNKSVVSEKDPKEEYSSKSSLRIMKSKSA
SGNIWDFPLSEDEDACPTCLEEYTSENPKIVTKCSHHFHLGCIYEWMERSENCPVCGKVMEFNETP*

DNA
ATGGGATGTGTTACTTCTTGCTTTCGAGTCCAAGACATTGATGAGTACATGAATCCAAATAGCTCTGTATATAGGAACTG
TCCCTGCATAAGATGCCTTGCTCGTAACTTCCTTAACCTGTATAGCTCGGTGTTCGGAAGAGGAGAAATACGCGCTCTGC
CATCTTCCGTTCAAGCGACCACTCCATCGATAACTTCCTCTTCTTCACACGATAACTTTCTTTCCGAAGCTTTCCGTTCT
ACTCCGAGGCCTCTGCCTTACGATGCTGATCCTAGACACTTCCGTTCACTCGTCTCACGGCGTGAGAAGGGTTCAAGTCA
CTCCCATGAGGAAGCTGAGCCTCTAAGGAGCGATAGCGATGCGGATTCTGAATCTTTCGGATGCAAATGGGCGAATAACA
AATCAGTTGTCTCTGAGAAAGATCCCAAAGAAGAGTACTCTAGTAAATCCAGTCTTAGGATTATGAAATCAAAGTCGGCG
TCTGGAAACATATGGGATTTTCCTTTGTCTGAAGATGAAGATGCATGTCCAACTTGTCTTGAAGAATATACATCAGAGAA
CCCAAAGATTGTAACAAAATGCTCTCACCATTTCCACCTTGGTTGCATTTATGAATGGATGGAGAGAAGTGAGAACTGTC
CTGTCTGCGGAAAGGTGATGGAATTCAATGAGACACCGTGA