Details for Kale Locus Bo5g152710

Position : C5 ( 5`- 46451448 .. 46453719 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152710

Protein [Map View]
MDIGEIIGEVAAPVSIPTKSAIYVWGYNQSGQTGRKGQESLLRIPKQLPPELFGCPAAGANSRWLDISCGREHTAAVASD
GSLFTWGANEYGQLGDGTEVGRKHPKKVKQLQSEFVKFVSCGAFCTAAIAEPRENDGTLSKSRLWVWGQNQGSNLPRLFP
GAFPANTAIRQVSCGTAHVVALSEDGFLQAWGYNEQGQLGRGVTCEGLQAPRVITAYAKFLDEAPELVKITQVSCGEYHT
AAVSETGEVYTWGLGSMGQLGHVSLQSGDKELIPRRVAGLDGVSMKEVACGGVHTCALSLEGALYAWGGGQAGQLGLGPQ
SGFLFSVSNGSEMLLRNVPVLVIPTDVRLVACGHSHTLVYMREGRICGWGYNSYGQAANEKSSYAWYPSPVDWCVGQVRK
LAAGGGHSAVLTDAFSLKELCEFQLADSVNLSNASEIQDVAFRMGSEALARLCERLREQFLDKDYPDGEEVY*

DNA
ATGGATATTGGAGAAATCATTGGCGAAGTTGCTGCTCCTGTGAGTATCCCAACAAAGAGCGCCATATACGTTTGGGGATA
CAACCAAAGCGGGCAAACCGGTAGGAAAGGGCAAGAGAGTCTTTTGCGTATCCCAAAACAGCTTCCTCCTGAGCTTTTTG
GTTGCCCTGCTGCTGGTGCCAATTCACGGTGGCTAGATATCTCCTGTGGTCGGGAACATACAGCCGCTGTTGCATCAGAT
GGATCTCTCTTCACTTGGGGGGCTAATGAATATGGTCAGCTTGGGGATGGAACCGAGGTTGGGAGGAAGCATCCAAAGAA
AGTGAAGCAGCTGCAGTCAGAGTTTGTGAAATTTGTGTCTTGTGGAGCTTTCTGCACTGCTGCTATTGCGGAGCCTCGTG
AAAATGACGGTACTCTTTCAAAGAGTAGACTCTGGGTTTGGGGACAAAACCAGGGGTCAAATTTGCCACGATTATTCCCA
GGGGCATTCCCTGCTAACACGGCAATTCGCCAAGTTTCATGTGGGACAGCTCATGTTGTGGCCTTATCAGAAGATGGCTT
TCTTCAAGCTTGGGGCTATAATGAACAAGGCCAACTTGGTAGAGGAGTCACTTGTGAAGGACTACAAGCACCTCGTGTGA
TAACTGCTTATGCGAAGTTCCTTGACGAAGCACCCGAGCTTGTGAAGATTACGCAAGTCTCATGTGGAGAATACCATACT
GCTGCTGTATCAGAAACGGGCGAGGTTTACACTTGGGGACTAGGAAGCATGGGCCAACTCGGCCATGTTTCTCTCCAATC
CGGGGATAAAGAGTTGATACCAAGGCGAGTCGCTGGTCTCGATGGTGTGTCCATGAAGGAAGTCGCTTGTGGCGGTGTAC
ACACTTGTGCTTTATCTCTGGAAGGAGCGCTTTACGCTTGGGGCGGTGGCCAAGCGGGACAGCTAGGTCTTGGTCCTCAG
TCTGGTTTCTTGTTTTCTGTCTCTAATGGAAGCGAAATGCTTCTGCGGAACGTCCCGGTTCTAGTCATCCCGACCGATGT
CAGGCTTGTTGCTTGTGGACATTCACACACTCTGGTTTATATGAGAGAGGGACGGATCTGTGGTTGGGGATACAATAGCT
ATGGTCAAGCGGCTAATGAGAAATCATCGTATGCTTGGTACCCTTCGCCTGTAGACTGGTGTGTGGGACAAGTGAGGAAG
CTAGCAGCAGGAGGTGGTCACTCAGCTGTTTTAACCGATGCATTCTCGTTGAAGGAGCTATGTGAGTTTCAGTTAGCAGA
TAGTGTGAACCTCTCGAATGCTTCAGAGATTCAAGATGTTGCATTCAGGATGGGTTCCGAAGCTTTAGCCCGCCTCTGTG
AAAGACTCAGGGAGCAGTTTCTTGATAAAGACTATCCTGATGGGGAAGAAGTATATTGA