Details for Kale Locus Bo5g152700

Position : C5 ( 5`- 46448722 .. 46450781 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152700

Protein [Map View]
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLDRYQKCSYGSVEV
NNKPAKELENSYREYLKLKGRYENLQLQQRNLLGEDLGPLNSKELEQLERRLDGSLKQVRCIKTQYMLDQLTDLQGKEHM
LLEANRALSIKLEDMIGVRSHQIGGAWEGGDQQNVAYGHHQAQSQGLFQSLECDPTLQIGYSHPVCSEQMAVTTQGQNQP
GNGYIPGWML*

DNA
ATGGGAAGGGGAAGAGTGGAGCTAAAGAGGATTGAGAACAAGATTAACAGACAAGTCACGTTTGCTAAGCGCAGGAACGG
TTTGCTGAAAAAAGCTTATGAGCTTTCTGTTCTCTGCGATGCTGAGGTTTCTCTCATCGTCTTCTCCAACCGTGGCAAGC
TCTATGAGTTCTGCAGCACCTCCAACATGCTCAAGACACTGGACAGATACCAGAAGTGTAGCTATGGTTCAGTTGAAGTC
AACAACAAACCTGCCAAAGAACTCGAGAATAGCTACAGAGAGTATTTGAAGCTGAAAGGTAGATATGAAAATCTGCAACT
TCAGCAGAGAAATCTACTTGGAGAGGACCTTGGACCTTTGAACTCAAAGGAGCTAGAGCAGCTTGAGCGTCGACTAGACG
GCTCTCTTAAGCAAGTTCGCTGCATCAAGACGCAGTATATGCTTGACCAGCTCACTGACCTCCAAGGCAAAGAGCATATG
TTGCTTGAAGCCAATAGAGCTTTGTCAATTAAGCTGGAAGATATGATCGGCGTGAGGAGTCACCAAATAGGAGGGGCATG
GGAAGGTGGTGATCAGCAAAATGTTGCCTATGGACATCATCAGGCTCAATCTCAGGGACTATTCCAGTCTCTTGAATGTG
ATCCCACTTTGCAAATTGGGTACAGCCATCCAGTGTGTTCAGAGCAAATGGCTGTAACAACTCAAGGTCAGAACCAACCA
GGAAACGGCTACATCCCTGGCTGGATGCTGTGA