Details for Kale Locus Bo5g152690

Position : C5 ( 5`- 46444318 .. 46445870 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152690

Protein [Map View]
MAVQPTRIGLAGLAVMGQNLALNIASKGFPISVYNRTTSKVDETVERAKKEGNLPVYGFHDPESFVNSIQKPRVIIMLVK
AGAPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVSENGFLYLGMGVSGGEEGARNGPSLMPGGSFDAYKNIEDI
LLKVAAQVRDSGPCVTYIGKGGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLSNEELHGVFTEWNKGELESFLVEIT
ADIFAIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPSPTIESSLDARFLSGLKDERVQAAKVFKEGGFGDVLTD
QTVDKKQLIDDVRKALYASKICSYAQGMNLIRAKSMEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYDRNAELANLLV
DPEFAKEIIERQSAWRRVVCLSINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDVEGSFHTEWFKI
ARQSKSNM*

DNA
ATGGCTGTTCAACCAACAAGAATAGGTCTAGCTGGACTAGCCGTGATGGGACAGAACTTAGCTCTCAACATTGCTTCCAA
AGGCTTCCCAATCTCAGTCTACAACAGAACAACTTCCAAAGTCGACGAAACCGTCGAACGAGCCAAGAAAGAAGGAAACC
TCCCCGTCTACGGCTTCCACGACCCTGAGTCCTTCGTCAACTCCATTCAAAAACCACGTGTCATAATCATGCTCGTCAAA
GCCGGTGCCCCCGTCGACCAGACCATCAAGACCCTCTCTGCTTATTTGGAAAAAGGTGATTGCATTGTGGACGGTGGTAA
CGAATGGTATGAGAACACCGAGAGGAGAGAAAAAGCCGTGTCTGAGAACGGTTTCCTCTACCTAGGAATGGGAGTCTCCG
GCGGCGAAGAAGGCGCTCGTAACGGCCCGTCTCTGATGCCTGGAGGGTCCTTTGACGCTTACAAGAACATCGAAGACATT
CTCCTCAAGGTTGCGGCTCAGGTCAGAGACAGTGGTCCTTGTGTGACTTACATTGGTAAAGGCGGGTCTGGGAACTTTGT
TAAAATGGTCCACAACGGGATCGAGTACGGTGACATGCAGCTGATTGCTGAAGCCTATGACGTTTTGAAATCCGTTGGTA
AGCTATCTAACGAGGAGCTTCACGGAGTCTTCACCGAGTGGAACAAAGGTGAGCTCGAGAGTTTCTTGGTGGAGATCACA
GCGGATATCTTCGCCATCAAGGATGATAAGGGAGATGGGCATTTGGTTGACAAGGTTTTGGACAAAACGGGAATGAAAGG
TACCGGGAAATGGACTGTGCAGCAAGCAGCTGAGCTCTCTGTTCCTTCTCCCACCATTGAATCCTCTCTCGACGCGAGGT
TCCTCAGCGGGCTAAAAGATGAGCGTGTGCAAGCCGCTAAGGTCTTTAAAGAAGGTGGGTTCGGAGATGTCTTAACCGAC
CAAACCGTTGACAAGAAGCAGCTCATCGACGACGTGAGGAAGGCTCTCTACGCGTCGAAAATCTGCAGCTACGCGCAAGG
GATGAACCTAATCCGCGCCAAGAGCATGGAAAAGGGCTGGGGCCTTAAGCTAGGCGAGCTGGCGAGGATCTGGAAAGGAG
GGTGCATCATCAGAGCAATCTTCTTGGACAGGATCAAGCAAGCTTACGACAGGAACGCAGAGCTGGCTAACCTCTTGGTG
GATCCCGAGTTTGCGAAAGAGATCATCGAGAGGCAGTCGGCTTGGAGAAGAGTGGTCTGCTTGAGTATCAACTCGGGTAT
TAGCACTCCCGGTATGTCTGCGAGTCTGGCGTACTTTGATTCTTACAGGAGAGAGAGGCTGCCGGCGAACCTTGTGCAAG
CTCAGAGAGATTACTTTGGTGCTCATACTTATGAGAGGACTGATGTTGAAGGCTCTTTCCACACCGAGTGGTTCAAGATC
GCAAGACAATCCAAATCCAACATGTGA