Details for Kale Locus Bo5g152640

Position : C5 ( 5`- 46426908 .. 46429265 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152640

Protein [Map View]
MQSSSEIHHHERCRPVFPTENTGPADSDKGKVRRRVMGKSSVPQICRQQSFGRDIGHAAAETYLITRLSFDLLGYLGVGY
RWITRLLALACYAILLMPGFLQVAYHYFFSPQVRRSIVYGDQPRNRLDLYIPPPTSAGLKPVVVFVTGGAWIIGNFPQGT
ISDMVRDVSQGISFVCNNISAFGGDPNRIYLMGQSAGAHISSCALIEQAIKESRGERITWSASQIKAYFGLSGGIMEGEE
SFEQYSPGTRLKEPRVRKAASLLTHIVLFHGSEDYSIPCEASKTFAEALQGVEVKTDLIVYNGKTHTDLFLQDPLRGGKD
ELFDHIVAVIHANDSDALSKDAVAPPRRRLVPEILLKLAGKVSPF*

DNA
ATGCAATCATCTTCGGAGATTCACCATCATGAAAGATGCCGTCCAGTGTTTCCAACGGAGAATACTGGCCCAGCGGATTC
CGACAAAGGAAAGGTTCGTCGTAGAGTAATGGGGAAGTCTTCGGTGCCTCAAATTTGCAGGCAGCAGTCGTTCGGTCGCG
ACATAGGCCATGCAGCGGCGGAAACGTATTTGATAACTCGTCTTAGCTTCGACCTTCTTGGTTATCTCGGGGTAGGTTAT
CGGTGGATCACAAGATTACTTGCTCTTGCTTGTTATGCAATCCTCCTTATGCCTGGTTTTCTTCAAGTTGCATATCATTA
TTTTTTCTCACCCCAAGTTAGGAGGAGTATTGTATATGGAGATCAACCCAGGAATAGGCTGGATTTGTACATACCACCAC
CAACAAGTGCCGGCCTCAAGCCTGTTGTAGTTTTCGTGACTGGTGGAGCTTGGATTATCGGAAACTTCCCTCAGGGAACA
ATTAGTGATATGGTAAGAGATGTTTCTCAAGGAATCTCGTTTGTCTGCAATAACATCTCTGCATTTGGAGGCGATCCTAA
TAGAATATATTTGATGGGACAATCAGCTGGTGCACATATCTCTTCTTGTGCTCTCATTGAACAAGCCATTAAAGAATCAA
GAGGAGAACGTATCACATGGAGTGCTTCTCAGATAAAAGCTTACTTCGGTTTATCTGGCGGCATAATGGAAGGAGAAGAG
TCATTTGAACAATACTCTCCTGGCACCAGATTGAAAGAGCCGAGAGTAAGGAAAGCTGCATCTCTATTGACTCACATTGT
GCTCTTTCATGGATCTGAAGATTACTCCATCCCATGTGAAGCAAGCAAGACTTTTGCAGAAGCTCTTCAAGGTGTTGAAG
TTAAAACAGACCTAATTGTCTACAATGGTAAAACTCACACCGATCTATTTCTTCAGGATCCTTTGAGAGGAGGTAAAGAC
GAGCTGTTTGATCATATAGTCGCTGTGATACACGCCAATGACAGTGACGCTTTGAGTAAAGATGCGGTTGCGCCGCCGAG
AAGAAGGCTTGTGCCGGAGATTTTGCTGAAACTGGCTGGTAAGGTCAGCCCTTTCTGA