Details for Kale Locus Bo5g152620

Position : C5 ( 5`- 46415217 .. 46416305 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152620

Protein [Map View]
MALSAIGFEGYEKRLEVSFLEPSIFQDSKGLGLRALTRSQLDQILTPAACEIVSSLSNDHLDSYVLSESSFFVYPYKVII
KTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETKK
WHVYAASSPQSSGDNNNVYTLEMCMTGLDREKASVFYKNGETGTMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEGDAI
STIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPEISVDLEDYGCRERTFESLGE
ESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSSCSSEDEKD*

DNA
ATGGCCTTATCTGCAATCGGTTTCGAAGGCTACGAGAAGCGCCTCGAGGTCTCTTTCCTCGAGCCAAGCATCTTCCAAGA
CTCCAAGGGTTTGGGTCTCCGTGCTCTGACCAGGTCCCAGCTTGACCAAATACTCACTCCCGCTGCCTGCGAGATCGTTT
CTTCTCTCTCCAACGATCATTTGGACTCTTACGTCCTCTCTGAGTCCAGCTTCTTTGTCTACCCTTACAAAGTCATCATC
AAGACTTGCGGCACCACCAAGCTCCTCCTCTCCATCCCGCCTCTTCTCAAGCTCGCCGGTGAGCTCTCTCTGAGTGTCAA
GTCTGTTAAATACACTCGTGGCTCCTTCCTCTGCCCTGGAGGGCAGCCTTTTCCTCACCGGAGCTTCTCCGAAGAAGTCT
CTGTTCTTGATGGTCACTTTACTAAGCTGGGCTTGAACAGCGTCGCCTACTTGATGGGGAACGATGACGAGACTAAGAAA
TGGCATGTCTACGCTGCCTCCTCTCCCCAGTCCTCCGGGGACAACAACAATGTCTACACGCTCGAGATGTGCATGACTGG
TCTAGACAGGGAGAAAGCCTCTGTCTTCTACAAGAACGGCGAGACCGGAACAATGACTGACAACTCTGGAATCAGAAAGA
TCCTCCCCAAGTCCCAGATCTGCGACTTTGAGTTCGAGCCGTGTGGCTACTCTATGAACTCCATCGAAGGAGATGCGATC
TCCACTATCCACGTGACCCCTGAGGATGGGTTTAGCTACGCTAGCTTCGAAGCTGTGGGTTATGACTTCAACACTATCGA
CCTGAGCCAGCTTGTGACTAGGGTCCTGTCTTGCTTTGAGCCGAAGCAATTCTCTGTAGCAGTGCACTCGAGCGTTGGGG
TGAACGCGTACAAGCCTGAGATCAGTGTAGACTTGGAAGATTATGGATGCAGAGAGAGGACTTTTGAGTCTTTGGGAGAA
GAGAGTGGAACGGTGATGTATCAGACGTTTGAGAAGCTAGGCAAGTACTGTGGGTCGCCTAGGTCTACGTTGAAGTGTGA
GTGGAGCAGCAACAATAGTAGCTGCAGCAGCGAGGACGAGAAGGACTGA