Details for Kale Locus Bo5g152610

Position : C5 ( 5`- 46411212 .. 46412549 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g152610

Protein [Map View]
MREAQLGAHTVRSHGMTLARTHMHDWIILVLLVVLECILLIIHPFYRFVGKDMMTDLSYPLKSNPVPIWSVPVYAMLLPL
VIFISIYFRRRDVYDLHHAVLGLLYSVLVTAVLTDSIKNAVGRPRPDFFWRCFPDGKAVYDTLGDVICHGDKSVIREGHK
SFPSGHTSWSFAGLGFLSLYLSGKIQAFDGKGHVAKLCIVILPLLVAALVGISRVDDYWHHWQDVFAGGLLGLVVSTFCY
LQFFPPPYHTEAWGPYAYFQVLEAARAQAQAAENGVAQGGNGEEEDGGFMGLHLVDNPSMRREEEDVEAGRVPRG*

DNA
ATGAGGGAGGCACAGCTAGGCGCTCACACTGTGAGGTCCCATGGAATGACACTCGCAAGGACTCACATGCACGACTGGAT
CATACTCGTACTACTCGTTGTCCTCGAGTGTATCCTCCTCATAATCCACCCGTTTTACCGCTTTGTCGGTAAAGACATGA
TGACTGATCTAAGCTACCCTCTGAAGAGTAACCCCGTACCAATCTGGTCTGTCCCGGTCTATGCAATGCTGCTGCCATTG
GTGATCTTCATATCTATCTACTTCCGTAGAAGAGACGTATACGATCTTCACCACGCGGTGCTAGGTCTGTTATACTCTGT
TCTGGTGACGGCAGTGCTTACAGATTCGATTAAGAATGCAGTTGGTAGACCACGCCCTGACTTCTTCTGGCGTTGTTTTC
CTGATGGCAAAGCTGTTTACGATACCCTTGGAGATGTGATATGCCATGGTGATAAAAGTGTCATAAGGGAAGGGCACAAA
AGCTTCCCAAGCGGACACACCTCTTGGTCTTTTGCGGGTCTAGGATTCTTGTCGCTGTATTTATCAGGGAAGATTCAAGC
GTTTGACGGTAAAGGCCACGTTGCGAAGCTATGCATTGTTATACTCCCTTTGCTAGTTGCGGCTCTTGTTGGTATATCCC
GTGTGGATGACTATTGGCATCACTGGCAAGACGTCTTTGCAGGAGGCTTGCTAGGTCTCGTGGTGTCTACGTTCTGTTAT
CTTCAATTCTTTCCACCACCTTATCACACCGAAGCGTGGGGGCCATATGCTTACTTCCAAGTGTTGGAGGCGGCACGAGC
ACAAGCGCAAGCAGCAGAGAATGGAGTGGCTCAGGGAGGTAACGGTGAAGAGGAAGACGGAGGGTTTATGGGTTTACATT
TGGTGGATAATCCGAGTATGAGGAGAGAAGAAGAAGATGTAGAAGCTGGTAGAGTGCCTAGAGGCTGA