Details for Kale Locus Bo5g151520

Position : C5 ( 5`- 46351775 .. 46352585 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151520

Protein [Map View]
MPLSLRLAPYPTALASTTGGYGPVKKQCRIPYSGVATTRIGFFSLDYGKRVESSVVRCSLETVNVNVGQVKEVDKDTFWP
IVKAAGEKIIVLDMYTQWCGPCKVIAPKYKALSEKYEDVVFLKLDCNPENRPLVKELGLRVVPTFKIFKDNKVVKEVTGA
KYDNLVEAIETARSTGGSSG*

DNA
ATGCCTCTCTCTCTCCGTCTCGCTCCATATCCTACGGCTTTAGCTTCAACCACCGGTGGATATGGTCCCGTGAAGAAGCA
GTGCCGCATCCCTTACTCCGGCGTCGCCACCACGAGGATTGGTTTCTTCTCACTGGATTATGGAAAAAGGGTAGAATCCT
CTGTGGTGAGGTGTAGCTTAGAGACAGTGAATGTAAATGTTGGTCAAGTGAAGGAAGTGGATAAGGACACCTTCTGGCCC
ATCGTTAAAGCCGCTGGTGAAAAGATTATTGTACTTGACATGTACACTCAATGGTGTGGACCATGTAAAGTGATTGCACC
TAAGTACAAAGCTTTATCAGAGAAGTACGAGGATGTTGTGTTTCTTAAGCTTGACTGCAACCCTGAAAACAGGCCATTAG
TAAAGGAGTTAGGATTAAGAGTGGTTCCAACTTTCAAAATCTTTAAGGATAATAAAGTCGTCAAGGAAGTTACCGGTGCC
AAATATGATAATCTGGTCGAAGCAATTGAAACAGCCAGGTCTACTGGTGGTTCTTCGGGATGA