Details for Kale Locus Bo5g151500

Position : C5 ( 5`- 46342010 .. 46343788 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151500

Protein [Map View]
MSAASLFNLSLIRFRSLSSSRFLRLPQSPLRSVSISPRKFRAFSGAAMTTDAGMDAVQRRLMFDDECILVDETDRVVGHD
SKYNCHLMENIEAKNLLHRAFSVFLFNSNYELLLQQRSKAKVTFPLVWTNTCCSHPLYRDSELIEENALGVRNAAQRKLL
DELGIVAEDVPVEEFTPLGRMLYKAPSDGKWGEHELDYLLFIVRDVQVEPNPDEVAEIKYVSREGLKELVRKADAGEEGL
KLSPWFRLVVDNFLMKWWDQVEKGTLGEAVDMKTIHKL*

DNA
ATGTCTGCTGCTTCTTTATTTAATCTCTCTTTGATTCGCTTCAGATCTCTCTCTTCTTCCCGGTTTCTCCGTCTTCCTCA
ATCACCGCTCCGATCCGTTTCCATATCACCGAGAAAGTTTCGAGCTTTCTCCGGTGCCGCAATGACGACAGATGCTGGGA
TGGATGCTGTTCAAAGACGCCTCATGTTCGATGACGAATGCATTCTTGTTGACGAAACTGATCGTGTTGTGGGGCATGAC
AGCAAATATAATTGTCATCTGATGGAAAATATTGAAGCTAAGAATTTGCTTCACAGGGCGTTTAGTGTATTTTTATTCAA
CTCGAACTATGAGTTACTTCTCCAGCAAAGGTCAAAAGCAAAGGTGACCTTCCCTCTAGTGTGGACAAACACTTGTTGCA
GCCATCCTCTTTACCGTGACTCAGAGCTTATCGAAGAGAATGCACTCGGAGTGAGGAATGCTGCACAGAGAAAGCTTCTC
GACGAGCTCGGTATTGTAGCTGAAGACGTACCAGTGGAAGAGTTCACTCCCTTGGGTCGTATGCTTTACAAGGCTCCTTC
TGATGGCAAATGGGGAGAGCACGAACTGGACTACTTGCTCTTCATCGTGAGGGATGTGCAGGTTGAGCCAAACCCGGACG
AAGTAGCGGAGATCAAGTATGTGAGCAGGGAAGGGCTGAAGGAGCTGGTGAGGAAAGCAGACGCAGGGGAGGAAGGTTTG
AAGTTGTCGCCGTGGTTCAGATTGGTGGTGGACAATTTCTTGATGAAGTGGTGGGATCAAGTTGAGAAAGGAACTCTCGG
TGAAGCTGTAGACATGAAGACCATCCACAAACTCTGA