Details for Kale Locus Bo5g151490

Position : C5 ( 5`- 46341343 .. 46341660 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151490

Protein [Map View]
MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKFECPHSKITAPDLKTMQIHHDSKHPKIPYEESKL
VNLHAVLAPVAESKPKPGIRGSLTK*

DNA
ATGACTGGCAAGGCCAAGCCGAAGAAGCATACAGCTAAGGAGATTCAAGCCAAGATCGATGCTGCGTTGACCAACAGAGG
CGGAGGAAAGGCGGGAATAGCCGATCGGACCGGGAAAGAGAAAGGTGGTCACGCTAAGTTCGAGTGTCCTCACTCCAAAA
TCACGGCTCCGGATCTCAAGACCATGCAGATCCATCACGATTCGAAGCATCCGAAGATCCCTTACGAAGAGTCCAAGCTC
GTGAATCTCCATGCTGTTTTAGCTCCGGTGGCTGAGTCCAAACCTAAACCTGGAATCAGAGGAAGCTTAACGAAGTAA