Details for Kale Locus Bo5g151470

Position : C5 ( 5`- 46335914 .. 46337953 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151470

Protein [Map View]
MRPTTMKPDHMHTNKHADEAEQLEETTLKTFTFRELATATKNFRQECLLGEGGFGRVYKGTLQPTGQVVAVKQLDKHGLH
GNKEFQAEVLSLGRLDHPNLVKLVGYCADGDQRLLVYDYVTGGSLQNHLHEPKSDREPMDWTTRMQIAYGAAQGLDYLHD
KVNPPVIYRDLKASNVLLDDDLCPKLSDFGLHKLGPGTGDKMVALTSRVMGTYGYSAPEYTRGGNLTLKSDVYSFGVVLL
ELITGRRALDTTRPNDEQNLVSWAQPLFGDPKRYPDMADPVLENKFSERGLNQAVAIASMCVQEEATTRPLISDVMVALS
FLSMSKEDGVPTTVPILSFRDKSMSIALSRHDSDLASSKLAVEDEKSSTSSDKESSVDSMKERVIKREEEDSLSESDDGS
GSNSDEEQEEDRNSLSTEPIDEKNQAQSLKINYRYSWEEVDVSDEKLSSKGSQKSNDESIYSCYDIEVDHDDLPRNEKHI
HLEHIHSSKSEDDQSVYFDDEPGDDNEISFHRIKSEVDVDYVEDDSGTSLHPVK*

DNA
ATGAGACCGACGACAATGAAACCAGACCACATGCACACGAATAAACATGCAGATGAAGCAGAGCAATTGGAAGAAACGAC
GTTGAAGACGTTCACTTTCCGAGAACTAGCGACCGCGACAAAGAATTTCCGGCAAGAATGTTTGTTAGGAGAAGGTGGCT
TCGGCAGGGTTTACAAAGGAACCCTTCAACCTACTGGCCAGGTGGTGGCTGTAAAGCAACTAGACAAGCATGGACTGCAT
GGGAACAAGGAGTTTCAAGCAGAGGTCTTGTCATTAGGCCGACTCGATCATCCCAATCTTGTTAAGCTTGTAGGCTATTG
TGCCGATGGAGATCAAAGACTTTTGGTTTATGATTATGTCACAGGAGGTTCTCTCCAAAACCATCTTCATGAGCCAAAAT
CAGACCGTGAACCAATGGACTGGACGACAAGGATGCAGATAGCGTACGGTGCAGCGCAAGGGCTTGACTATTTGCACGAT
AAAGTGAATCCACCCGTGATATACCGTGACTTGAAAGCTTCAAACGTTTTGTTGGACGATGACTTGTGTCCTAAGCTTTC
TGACTTTGGCCTGCATAAGCTAGGACCAGGGACAGGTGATAAGATGGTGGCTTTAACTTCTCGAGTAATGGGAACTTATG
GTTACTCCGCTCCTGAGTATACACGAGGAGGAAATCTCACCTTGAAATCAGATGTCTATAGCTTTGGAGTTGTGTTGCTT
GAGCTCATCACTGGTCGAAGAGCTCTTGATACTACTAGACCTAATGATGAACAAAACTTAGTTTCTTGGGCACAACCATT
GTTTGGAGATCCAAAGAGATATCCTGATATGGCAGATCCAGTTCTTGAGAATAAATTTTCAGAGAGGGGACTAAACCAAG
CGGTGGCGATAGCTTCAATGTGTGTGCAAGAGGAGGCAACAACTCGTCCTCTGATAAGCGATGTAATGGTTGCACTTAGC
TTCCTTTCCATGTCTAAAGAAGACGGTGTTCCCACAACTGTTCCTATCTTATCCTTCAGGGACAAGAGCATGTCTATAGC
CTTAAGCCGACATGATTCAGATCTTGCATCTTCTAAACTAGCAGTAGAAGATGAAAAGTCTAGTACATCATCAGACAAAG
AATCATCTGTGGACAGCATGAAGGAGAGAGTAATCAAACGTGAGGAGGAAGATAGCTTGAGCGAATCTGATGATGGGTCT
GGTTCTAACTCGGATGAAGAACAAGAAGAGGATCGAAACAGTTTATCAACAGAGCCTATTGATGAGAAGAACCAGGCGCA
GAGCTTGAAGATAAACTATAGATATAGTTGGGAAGAAGTGGATGTTAGTGATGAGAAGCTAAGCAGTAAAGGCAGCCAGA
AATCAAATGATGAGAGCATATATTCGTGCTATGATATTGAAGTAGATCATGATGATTTACCTAGGAATGAAAAGCATATT
CATCTTGAGCACATTCATAGCTCGAAATCCGAGGATGATCAAAGTGTTTATTTTGATGATGAGCCAGGAGATGACAATGA
GATATCTTTTCATCGGATAAAATCGGAGGTGGATGTTGATTATGTTGAAGATGACAGTGGAACTTCTTTGCACCCAGTTA
AATAA