Details for Kale Locus Bo5g151410

Position : C5 ( 5`- 46319584 .. 46321252 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151410

Protein [Map View]
MDAQAKKKALFRSKLNAKKKDSRIDSPLVRYNESDQPVCRVCNVVLKSESLWDVHQASRKHHEAIDNLKASAAGVQRGSK
PAETKPTKLVESSAAAISSNSQTSSSGLPPNFFESSIKHPESAEVESSKPKNVHQGSETNKTKGPLPEGFFDNQQTDSSD
TKPTIEPKESQTQATGTVVKGALPTGFFDNKEADLLARGIKLVKPDIKDEYKEFEKLIQEDLQVVDSRMEEEEVDAAETI
EEEEQREQRSYKEKVEILKKRKMELKAARLAKRSKTAEGSVKKPKKTEEESPSDDEDDEDSAVDWRAQHV*

DNA
ATGGATGCTCAAGCGAAGAAGAAGGCGTTGTTCCGCTCCAAACTCAACGCCAAGAAGAAAGACTCCCGCATCGATTCTCC
TCTCGTTAGGTACAACGAATCAGACCAGCCTGTGTGCCGAGTGTGCAATGTCGTGTTGAAGTCTGAATCACTATGGGATG
TCCACCAAGCTTCTCGTAAGCATCACGAGGCAATCGATAATTTAAAGGCTAGTGCAGCTGGAGTTCAACGAGGTAGCAAA
CCTGCTGAAACTAAGCCAACAAAACTTGTAGAAAGTTCGGCTGCTGCTATATCATCCAATTCTCAGACATCATCATCTGG
TCTTCCTCCTAATTTCTTCGAGTCTTCTATTAAACATCCTGAATCTGCAGAAGTTGAATCGTCAAAACCTAAGAACGTGC
ATCAAGGTTCAGAAACAAATAAGACTAAAGGACCTCTTCCAGAGGGATTCTTCGATAATCAGCAAACTGATTCTTCAGAT
ACCAAACCCACGATTGAGCCTAAAGAGAGTCAGACGCAGGCGACTGGTACAGTGGTGAAGGGAGCCCTTCCCACTGGTTT
TTTCGATAATAAAGAAGCTGACCTGCTTGCCCGTGGAATAAAGCTTGTCAAACCAGATATTAAGGACGAATATAAAGAAT
TTGAGAAGTTGATACAAGAAGATCTGCAAGTAGTGGATAGTCGCATGGAAGAAGAAGAGGTTGATGCTGCGGAAACCATT
GAGGAGGAGGAACAACGAGAGCAAAGATCATACAAAGAGAAAGTGGAGATTCTGAAGAAGAGGAAGATGGAACTGAAAGC
GGCTAGATTAGCTAAGCGCAGCAAAACCGCTGAAGGGTCAGTTAAAAAGCCGAAGAAGACTGAAGAAGAATCGCCCAGCG
ATGATGAGGATGACGAGGATTCTGCTGTTGATTGGAGAGCTCAGCATGTTTGA