Details for Kale Locus Bo5g151400

Position : C5 ( 5`- 46317007 .. 46318791 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151400

Protein [Map View]
MAENGSLDQFLAAAVDAAQKAGQVIRKGFYETKHVEHKGQVDLVTETDKGCEELVFNHLKQLFPNHKFIGEETTAANGVT
ELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKVPVVGVVYNPIMDEMFTGVQGKGAFLNGKPIKVSTQSELVTALL
LAEAGTKRDKATLDDATNRINSLLTKVRSLRMGGSCALDLCGVACGRGDIFYEIGFGGPWDIAAGIVIVREAGGLIFDPS
GKELDITSQRIAASNASLKELFVEALRLTNV*

DNA
ATGGCTGAAAATGGTTCTCTAGATCAGTTCTTGGCTGCTGCCGTTGATGCCGCTCAAAAAGCTGGACAGGTCATTCGTAA
AGGCTTTTACGAGACCAAACATGTCGAACACAAAGGCCAGGTGGATCTGGTGACGGAGACTGATAAAGGATGTGAAGAGC
TCGTGTTTAACCATCTCAAACAGCTTTTCCCCAATCACAAGTTCATTGGAGAAGAAACAACAGCTGCGAATGGTGTGACT
GAACTAACAGACGAACCAACTTGGATCGTTGATCCTCTTGATGGGACTACTAACTTCGTTCACGGGTTCCCTTTTGTCTG
TGTTTCCATTGGACTTACCATTGGGAAAGTCCCTGTGGTTGGCGTCGTCTATAATCCTATCATGGATGAGATGTTCACAG
GTGTCCAAGGGAAAGGAGCCTTCTTGAATGGCAAACCAATCAAAGTGTCAACTCAGAGCGAGCTTGTAACCGCTTTGCTC
CTAGCAGAGGCGGGCACTAAAAGAGATAAAGCTACATTAGACGATGCTACCAACAGAATCAACAGTTTGTTAACCAAGGT
GAGGTCCCTGAGGATGGGTGGCTCGTGCGCACTGGACCTCTGCGGTGTCGCTTGTGGAAGGGGTGACATCTTCTATGAAA
TTGGTTTTGGCGGTCCATGGGACATTGCAGCAGGAATTGTGATTGTTAGAGAAGCTGGTGGACTTATTTTTGATCCATCT
GGTAAAGAGTTGGACATCACATCGCAGAGAATTGCGGCTTCAAACGCTTCACTCAAGGAGTTGTTCGTGGAGGCGTTGCG
GCTTACAAATGTGTGA