Details for Kale Locus Bo5g151380

Position : C5 ( 5`- 46310712 .. 46312758 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151380

Protein [Map View]
MKKGSLFVFFLFLAAVTSDLDSDRRALLLLRNSVRGRPLLWNTSASSPCAWHGVHCDSGRVTTLRLPGAGLFGSLPLGGI
GNLTQLQTLSLRFNSLSGPIPSDFSNLALLRYLYLQGNAFSGEIPPFLFTLPSIIRINLGENRFSGRIPDNVNNATRLVT
LYLEKNQLTGSIPEITITLQQFNVSSNQLNGSVPDSLSGFPQSAFEGNTLCGKPLNPCEGDAETPNSPPVSPPSPPGKKD
SDKLSAGAIAGIVIGSVAGLLLLLLIIFCLCRKKKGEENGQPRNVEAPVAAATSAAVHKESSAANVPPAKASGSGGGAVS
KDLTFFVKSFGEFDLDGLLKASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPEKDFRERLQVLGSMSHPNLVTLIA
YYFSPDEKLLVSEYMSRGSLSALLHGNKGNGRAPLNWETRAGIALGAARAISYLHSRDSTTSHGNIKSSNILLSNSYEAK
VSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLTEEGVDLPRWVQSITDQQSP
SQVFDPELAGHQSEGNENMIRLLKIGISCTAQYPDSRPSMADVTRLIEEVSHSSGSPNPISG*

DNA
ATGAAGAAGGGCTCTCTCTTCGTCTTCTTCCTCTTCCTCGCGGCGGTGACTTCAGATCTAGACTCCGACCGGCGAGCGTT
ACTCCTCCTCCGCAACAGCGTCCGTGGCCGTCCCTTGCTATGGAACACGAGCGCCTCCTCTCCTTGCGCCTGGCACGGAG
TCCACTGCGATTCGGGTCGGGTCACCACCCTCCGATTACCCGGAGCGGGTTTGTTCGGCTCGTTGCCTCTCGGAGGAATC
GGTAATCTGACTCAGCTCCAGACGCTTTCTCTCCGATTCAACTCGCTCTCCGGTCCAATCCCCTCGGATTTCTCCAACCT
CGCTCTCCTCCGTTACTTGTATCTCCAAGGTAACGCATTCTCCGGCGAGATTCCGCCGTTTTTGTTCACGCTTCCAAGCA
TTATCAGAATCAATCTCGGGGAGAATCGATTCTCGGGTCGGATCCCGGATAATGTTAATAACGCGACCCGGTTGGTTACG
CTTTATTTAGAGAAGAATCAGCTCACCGGTTCGATCCCTGAGATTACAATCACTCTTCAGCAATTTAATGTCTCTTCTAA
TCAGTTAAACGGGTCGGTTCCGGATTCTCTCTCGGGTTTTCCCCAATCCGCTTTCGAAGGGAACACTCTCTGTGGGAAGC
CGTTAAACCCTTGCGAAGGCGACGCCGAAACCCCTAATTCGCCGCCGGTTTCTCCGCCGTCTCCGCCGGGGAAGAAAGAT
AGCGACAAGCTATCCGCCGGAGCCATCGCCGGGATCGTGATCGGATCTGTCGCCGGTCTGTTGCTGCTTCTCTTGATTAT
CTTCTGTCTCTGCAGGAAGAAAAAAGGAGAAGAGAACGGTCAGCCGAGAAACGTCGAAGCTCCCGTCGCCGCCGCGACCT
CCGCCGCTGTACACAAGGAATCATCGGCGGCTAACGTCCCTCCGGCGAAGGCGTCGGGGAGCGGCGGCGGCGCGGTGAGT
AAGGACTTGACGTTTTTCGTGAAGTCTTTCGGGGAATTCGATTTGGATGGGTTGCTGAAGGCTTCGGCTGAGGTTCTTGG
GAAAGGGACGGTTGGGTCTTCGTATAAGGCGAGCTTTGAGCATGGTTTAGTGGTTGCTGTGAAACGGTTACGAGACGTTG
TGGTGCCTGAGAAGGATTTTAGAGAGAGGTTGCAGGTTTTGGGATCGATGAGTCATCCTAATCTCGTGACCCTCATCGCT
TATTACTTCAGTCCCGACGAGAAGCTTCTTGTCTCTGAGTACATGTCTAGAGGAAGCTTGTCTGCCCTATTGCACGGGAA
CAAAGGTAATGGGAGGGCTCCGTTGAACTGGGAAACTAGAGCTGGTATAGCATTGGGAGCTGCAAGAGCGATTAGTTATC
TCCATTCGCGTGATTCGACAACTTCTCATGGAAACATCAAGTCTTCGAACATACTCTTGTCTAATTCATATGAAGCTAAG
GTTTCTGATTACGGTCTAGCGCCTATCATTAGCTCCACATCTGCGCCTAACCGTATCGATGGCTACCGTGCCCCTGAAGT
CACTGATGCGCGCAAAATCTCTCAAAAAGCTGATGTTTACAGCTTCGGTGTGCTTATCCTTGAACTACTCACAGGGAAGT
CTCCAACACATCAGCAATTAACCGAAGAAGGTGTAGATTTGCCAAGATGGGTCCAATCCATTACTGATCAACAATCACCA
TCTCAAGTGTTTGATCCGGAGCTCGCCGGGCACCAATCAGAGGGCAATGAGAACATGATCCGTCTCTTGAAGATTGGTAT
AAGTTGTACAGCGCAGTACCCTGATAGTCGTCCTTCCATGGCCGATGTTACCAGACTCATCGAGGAGGTTTCGCATTCAT
CTGGCTCCCCAAATCCTATATCTGGCTGA