Details for Kale Locus Bo5g151370

Position : C5 ( 5`- 46305884 .. 46306465 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g151370

Protein [Map View]
MGHGTMATPPTTTITPTKTTLVFTYGTLKRGFSNHVLMQDLIRSGDASLKGVYQTLEKYPLVCGPYRVPFLLNKPGTGHR
VTGELYAVSPRGLSRLDELEGITRGHYVRQPIRLAAAEKEGGDLEAEHATSSCVVEAYYAHKSYEEELWKRNGGRSFGAY
TENEARGYVKRKDRPQHLTFLDHIRIFVSSPCD*

DNA
ATGGGCCACGGAACAATGGCGACACCACCGACCACCACCATCACCCCTACCAAGACGACGCTCGTGTTCACGTACGGAAC
TCTAAAGAGAGGATTCTCGAACCACGTCCTGATGCAAGATCTGATCCGATCAGGCGACGCATCTTTAAAAGGAGTCTACC
AAACGCTAGAGAAATATCCCCTCGTCTGCGGACCATACCGAGTCCCTTTCCTCCTCAACAAGCCTGGAACGGGCCATCGC
GTGACGGGAGAGCTTTACGCGGTCTCTCCTCGCGGTCTCTCGCGTCTCGACGAGCTCGAAGGGATCACCAGGGGACATTA
CGTGAGGCAACCGATCCGTCTAGCTGCTGCTGAGAAAGAAGGAGGAGATCTGGAAGCAGAGCATGCGACGTCGTCGTGCG
TGGTGGAGGCGTATTACGCGCACAAGAGCTACGAGGAGGAGCTGTGGAAGAGGAATGGAGGGAGATCGTTCGGCGCGTAC
ACGGAGAACGAAGCGCGTGGATATGTGAAGCGTAAGGATCGGCCGCAGCATCTTACCTTCTTGGACCATATCCGTATTTT
CGTTTCTTCTCCATGTGATTAA