Details for Kale Locus Bo5g150340

Position : C5 ( 5`- 46268571 .. 46269374 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150340

Protein [Map View]
MSVKARRISGRLETVVAKPTYAFDPVDDDKIIRNRLLTRTTTTRGEPPLKKLQKKFTSFVLEVDKEEDNYAECNRLAKAF
LQELTTFEIPLLKSQAVVEANVREKESFDEVKVETERQIMQAKGEIEELKKQLEESKIERQHKEECETIRKLISAQPPRA
ETEKVIAELKREIAELEAESTASWRLLELRKKQFALLLHVVDELQNTMEDEQKSLVDEIRTAVEDQRNTTEPMSVD*

DNA
ATGTCAGTGAAAGCAAGGAGGATCTCCGGGAGATTAGAGACTGTAGTAGCCAAACCTACTTACGCCTTCGACCCCGTCGA
CGATGACAAGATCATAAGAAACCGTCTCCTCACCCGAACCACCACCACACGAGGCGAGCCTCCCTTAAAGAAGCTCCAGA
AGAAGTTCACTTCCTTCGTCCTCGAAGTCGACAAAGAGGAAGACAACTACGCCGAGTGCAACCGCCTCGCGAAGGCCTTC
TTGCAGGAGCTAACCACCTTCGAGATCCCTCTTCTCAAGAGCCAGGCGGTCGTGGAAGCTAACGTTAGGGAGAAAGAGAG
CTTCGACGAGGTGAAGGTTGAGACCGAGAGGCAGATCATGCAGGCGAAAGGTGAGATCGAGGAGCTGAAGAAGCAGCTTG
AGGAGAGTAAGATTGAGAGGCAGCATAAGGAAGAGTGCGAGACGATTAGGAAGTTGATCTCCGCGCAGCCGCCGAGGGCG
GAGACTGAGAAGGTGATTGCTGAGTTGAAGAGGGAGATTGCTGAGCTTGAAGCGGAGAGCACTGCGAGCTGGAGGTTGCT
TGAGCTGAGGAAGAAGCAGTTTGCTCTCTTGTTGCATGTGGTGGATGAGTTGCAGAACACAATGGAAGATGAGCAGAAGA
GTCTAGTGGATGAGATTCGGACAGCCGTGGAAGATCAGAGGAACACAACCGAGCCCATGTCTGTGGATTAA