Details for Kale Locus Bo5g150330

Position : C5 ( 5`- 46265846 .. 46267395 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g150330

Protein [Map View]
NKQNGDADNKSKNQKNGDSNKSDTKNQKNGDADKSDKKNQCKEIVLKVYMHCEGCASQVSHCLRGYDGVEQIKIEVGENK
VVVSGKFDDPVKILRRVQKKFSKNAELISPKPNPNQDQKKEQQQKKESTPQIKTAILKMNIHCEGCVNEIKRGIEKIKGI
QTAEPDRSKSMVVVRGVMDPPKLVEEIKKKLKRHAELVSQNTEKGKGNNDKESNNNNKGNKKNEDSDGNTIFSYPPQYSA
QHNYPSQIFSDENVHSCSIM*

DNA
AACAAGCAAAATGGAGACGCAGACAACAAGTCCAAGAATCAGAAAAATGGAGACTCCAATAAGTCAGATACGAAGAATCA
GAAAAATGGAGATGCCGATAAGTCTGATAAGAAGAATCAGTGTAAAGAAATTGTTCTGAAGGTTTACATGCACTGTGAAG
GTTGCGCTTCACAAGTTTCCCATTGTTTGAGGGGATATGATGGGGTTGAGCAAATTAAGATAGAGGTTGGAGAAAATAAA
GTCGTTGTGTCTGGGAAATTTGATGATCCGGTGAAGATATTACGAAGGGTGCAAAAGAAATTCAGTAAAAATGCTGAGTT
AATTTCCCCAAAGCCTAACCCTAATCAAGATCAGAAGAAGGAGCAACAACAAAAGAAAGAAAGTACTCCGCAGATCAAAA
CTGCAATTTTAAAAATGAACATTCACTGTGAAGGATGTGTTAATGAAATCAAAAGAGGCATTGAGAAAATAAAAGGTATT
CAAACGGCGGAACCAGACCGGTCAAAGTCAATGGTGGTGGTACGAGGAGTCATGGATCCTCCAAAACTCGTGGAGGAAAT
CAAGAAAAAACTTAAGAGACATGCAGAGCTTGTAAGTCAGAACACAGAGAAAGGCAAAGGTAATAACGACAAAGAGAGCA
ATAACAATAACAAGGGCAACAAGAAGAACGAAGACAGTGATGGAAACACAATCTTTAGTTACCCTCCTCAATATTCAGCC
CAGCATAACTATCCCTCTCAGATTTTTAGCGACGAGAATGTGCATTCTTGTTCGATCATGTGA